KEGG   Bacteroides fragilis NCTC9343: BF2676Help
Entry
BF2676            CDS       T00239                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfs01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bfs00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3117914..3118726
Genome map
AA seq 270 aa AA seqDB search
MKDILSEIIANKRFEIDLQKQAIPSEQLQEKLSDEVQPGYSMKQALASSATGIIAEFKRR
SPSKGWIYENACPEQVVPDYIAAGASALSILTDEKFFGGSLKDIRTARPLVNIPILRKDF
IIDEYQLFQAKIVGADAILLIAAALEADQCHALAAKAHELGLEVLLEIHTAEELPFINKE
IDMVGINNRNLGTFFTDVENSFRLAGQLPQDALLVSESGISDPETVKRLRKAGFRGFLIG
ETFMKTQQPGQKLKEFINDLNSPQSDTESH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatattatctgaaatcattgccaataaacgttttgagatcgacctgcagaaa
caggccatcccatcggaacagcttcaggagaagttatctgacgaggtacagccgggctac
tccatgaagcaggcactggcctcttcggctaccggtatcattgccgagttcaaacgccgg
tctccgtccaaaggctggatctatgaaaatgcatgtccggaacaagtcgtgccggactat
atagccgccggtgcttcggcgctttctatactcacggatgaaaaattcttcggaggaagc
ctgaaggatattcgcacagcacgccctttggtgaatatcccgatcctgcgcaaagatttt
ataatcgatgaatatcaactgttccaggccaaaattgtgggagctgacgccatattgctg
atagccgccgcactggaggccgatcaatgtcatgcgcttgccgcaaaagcccatgaattg
ggactggaagtcttgctagagattcatactgccgaagaactgccatttataaataaggag
atagacatggtaggtatcaataaccgcaacctgggcactttcttcacagatgtagagaat
tctttccggttagccggacagttgcctcaggatgcgctgttggtatcggaaagcggcatc
tcggatccggaaacagtgaaacgcctgcgtaaagccgggttccggggattcctgatcgga
gaaacgtttatgaaaacccaacagcccggacagaaattaaaagaatttataaacgacctg
aattcaccacagagtgacacagagtctcactga

DBGET integrated database retrieval system