KEGG   Bacteroides fragilis NCTC9343: BF3205Help
Entry
BF3205            CDS       T00239                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfs00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bfs00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bfs00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3766034..3770059
Genome map
AA seq 1341 aa AA seqDB search
MRKITLGLILCSMVTLCFAGQRPLEGFKYASEKAPVGNEWESPENIALNKEQPRAWFFSF
QDVESARKVLPENSKYWLSLNGDWKFNWAPDPDSRPKDFYQTTFDVSGWDNIPVPSSWNI
YGIQKDGSLKYGVPIYVNQPVIFMHKVKVDDWRGGVMRTPPTNWTTYKYRNEVGSYRRDF
DIPQDWDGREVFINFDGVDSFFYLWINGQYVGFSKNSRNTASFNITPYLQKGKNTVAAEV
YRSSDGSFLEAQDMFRLPGIFRTVALYSTPKVQVRDLVVIPDLDETYTNGSLAISADIRN
FGKKAAKGYQMAYTLYANKLYSDENTPVANAVASATVNLVNPNETVEAEKAIMNVQSPNK
WSAEFPHLYTLVAELKDKKGKTIETVSTTVGFRKVEIKDTPASADEFGLAGRYYYVNGKT
VKLKGVNRHESNPAVGHAITREMMEKEVMLMKRANINHVRNSHYPDDPYWYYLCNKYGLY
LEDEANIESHEYYYGAASLSHPVEWKNAHVARVMEMVHANVNNPSIVIWSLGNEAGPGKN
FIAAYDALKAFDLSRPVQYERNNDIVDMGSNQYPSIGWMRGAVKGNYDIKYPFHVSEYAH
SMGNACGNLVDYWEAIESTNFFCGGAIWDWVDQSMYNYDKKTGERYLAYGGDFGDTPNDG
QFVMNGIVFGDLEPKPQYYEVKKVYQHIDVKAIDVEKGRFEVFNKYYFKNLSDYDVKWSL
YENGKEAQSGLLSIGEVAPRTRTQITVPYQFSKLKADSEYFVKIQFLLKDNMPWADKNFA
QAEEQILVKEATARPSIATVAAEGDKPEVMMTKASDIITIKGNGYTAQFDIKTGTIYSLT
YGNEKVITDGNGPKLDALRAFTNNDNWFYSQWFDNGLHNLKHSATGFNMTTKEDGTVVLS
FTVQSQAPNAAKILGGTSSGKNKIEELTDKKFGSSDFKFTTNQVWTVYKDGSIELEASIT
SNQPSLVLPRLGYMVRVPQQYANFTYYGRGPIDNYADRKVGQFIEQHKNTVAGEFVNFPK
PQDMGNHEDVRWCALTNNAGNGAVFIATDRLSASALPYSALDLILASHPYQLPKAGDTYL
HLDAAVTGLGGNSCGQGGPLEQDRVFASHHNTGFIIRPAGKDLTVTANVAPAGEMPLSIT
RNRAGVVSVSSQKKDAVILYTVDKSKSKTYTEPIALRNGGTVTAWFKDAPFIKASMTFDK
IESIQTEVIYASSEESDGGEAKNLTDGDPNTIWHTMFSVTVAKHPHWVDLDAGEVKTIKG
FTYLPRQDSSNGNVKDYTIHVSMDGKEWGEPILKGTFARDLKEKKVMFDKPVKARYIRFT
ALSEQRGQDYASGAELTILAE
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaatcacgttaggtctgatactatgcagcatggttacgctctgctttgccggt
caacgacctttagagggatttaagtatgcctcggaaaaagccccggtgggcaatgaatgg
gaatcaccggagaacattgcactcaacaaagaacaaccacgagcctggttcttttccttc
caggatgtggaaagcgcacgcaaagtgttaccggagaacagtaaatactggttgtcactg
aatggtgactggaaattcaattgggcacccgatccggattctcgccccaaagatttttat
cagactactttcgatgtttcgggctgggacaacattcccgtcccttcaagctggaatatc
tatggtatccagaaagacggtagcctgaaatacggagtacctatctatgtgaaccaacct
gtcattttcatgcacaaagtgaaagtagacgactggcgcggaggtgtgatgcgtactcct
cccactaactggactacttataaataccgtaacgaagtgggttcctaccgtcgcgacttc
gacatcccccaagattgggacggtcgtgaagtatttatcaacttcgacggtgtggactct
ttcttctacctctggatcaacggccagtacgtaggtttctcaaaaaactcacgcaatacg
gccagtttcaatatcaccccctatctgcaaaaaggaaagaacaccgttgctgccgaagta
taccgcagttcagacggctcgttcctcgaagcacaggatatgttccgcttaccgggtatc
ttccgtaccgtagctctctactctactccaaaagtacaggtacgtgacctcgtggtaatc
cccgacctggacgagacatacaccaacggttcgttggccatcagcgccgacatccgcaac
tttggcaagaaagcagccaaaggataccagatggcgtatacactatatgctaataaactg
tactcggatgaaaacactccggttgccaatgccgttgcttcggccactgtgaatctggtg
aacccgaacgaaaccgtagaagcggaaaaagcgatcatgaacgtacagtcccccaacaaa
tggtcggctgaattcccccacctctacacactcgttgcagaactgaaagacaagaaaggc
aaaacaatagaaaccgtttcgactaccgtaggtttccgcaaagtggaaatcaaagatact
cctgcttctgctgacgaattcggactggcaggccgctattactacgtaaacggcaaaacc
gtaaaactgaaaggtgtcaaccgccacgaatcaaatccggctgtgggacatgccatcacc
cgtgaaatgatggagaaagaggttatgctgatgaaacgtgccaacatcaatcacgtacgt
aactctcactatccggacgatccgtactggtactatctgtgcaacaaatacggactctac
ctggaagatgaagccaacatcgaatctcacgagtattattacggagccgcttccctgtct
catccggtggaatggaaaaacgcccatgtagcccgtgtgatggaaatggttcatgccaac
gtaaacaatccttcgattgtcatctggtcattaggcaacgaagccggaccgggaaagaac
ttcatagcagcttacgatgcactgaaagcattcgacctctcacgccctgttcagtatgaa
cgtaacaacgatatcgtcgatatgggttccaaccagtatccttccatcggctggatgcgc
ggtgctgtgaaaggcaactatgacatcaaatatccgttccacgtttcggaatatgctcac
tctatgggtaacgcctgcggtaacctggtggactactgggaagctatcgaatcgaccaac
ttcttctgcggcggcgcaatctgggactgggtagaccaatcgatgtacaactatgacaag
aaaaccggtgaacgctacctggcttatggcggtgatttcggcgatactccgaacgacggt
caattcgttatgaacggtatcgtattcggcgatctggaaccgaaacctcagtattatgaa
gtgaaaaaggtataccagcacatcgacgtgaaggctatcgatgtagaaaaaggccggttt
gaagtgttcaacaagtattacttcaagaacctttcggactatgatgtgaaatggtcactc
tacgaaaacggcaaagaagcacaatcgggcctattgagcataggcgaagtagctccgcgt
acccgtacgcagattactgttccttatcagttcagtaagctgaaagccgattcggaatat
ttcgtgaagattcaattcctgctgaaagacaacatgccttgggctgacaagaacttcgca
caagcagaagaacagatacttgtgaaagaggctaccgcacgtccttctatcgccaccgta
gcagccgagggcgacaaaccggaagtgatgatgactaaagcgagcgatatcattaccatc
aaaggcaatggttacacagctcagttcgatatcaagacaggtactatctacagtctgaca
tacggaaacgagaaggtgattactgacggcaacggtccgaagctggatgcgctccgtgct
ttcaccaataacgataactggttctattcacagtggtttgataatggtttgcacaacctg
aagcattcagctaccgggttcaatatgactaccaaagaagatggtacagtcgtattgtca
ttcacagtacagtctcaggctcctaatgcagccaagattctgggtggaacaagctcgggc
aagaacaagattgaggaactgacagacaagaagttcggcagcagtgacttcaagtttact
accaaccaggtatggacagtctacaaagacggttctatcgaactggaagcaagcatcacc
tccaatcagccgagtctcgtattgcctcgtctgggatacatggtacgtgtgcctcagcaa
tatgccaactttacttactacggacgcggtcctatcgacaactacgccgaccgtaaagta
ggacagttcatcgagcaacataagaatacggttgccggagagttcgtcaacttccccaaa
ccgcaagatatgggtaatcacgaagacgtacgctggtgtgccctgaccaacaatgcaggc
aacggtgccgtgtttatagctaccgaccgtttgtcggcttcagctctgccttactctgca
ctcgacctgattctggcttcacatccgtatcagttaccgaaagccggtgatacttatctt
cacctggatgcagccgtaaccggcctgggtggtaacagctgcggtcaaggcggcccgttg
gagcaagaccgtgtcttcgccagccatcacaacacaggtttcattatccgccccgcaggt
aaagacctgactgtaacagccaatgtagctcccgccggagagatgccgttgtccataacc
cgcaaccgtgccggtgtggtatctgtatcatcacagaaaaaagacgccgttatcctttat
acagtagataagagtaaatccaaaacttataccgaaccgatcgcactacgcaatggcggt
acggtgactgcctggttcaaagatgcacctttcatcaaggcaagcatgacattcgacaag
atcgaaagcatccagacagaagtaatctacgcaagtagcgaagaatcggacggtggcgaa
gccaagaacctgacagacggtgatccgaataccatctggcacaccatgttctctgtaacg
gtggctaaacacccgcattgggtagacctggatgccggcgaagtgaaaacaatcaaaggt
ttcacttacctgccccgtcaggacagcagcaacggtaatgtgaaagactacaccatccac
gtaagtatggacggtaaagaatggggtgaacctatcctgaaaggtactttcgcaagagac
ctgaaagagaagaaagtaatgttcgataaacctgtgaaagcccgttatatccgcttcacc
gccttgagcgaacaacgcggacaagactatgcttcgggtgccgaactgactatcctggct
gaataa

DBGET integrated database retrieval system