KEGG   Bacteroides fragilis NCTC9343: BF3437Help
Entry
BF3437            CDS       T00239                                 

Gene name
gdhB
Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bfs00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bfs00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bfs00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4055197..4056534
Genome map
AA seq 445 aa AA seqDB search
MNIEKIMSSLEAKHPGESEYLQAVKEVLLSIEDIYNQHPEFEKAKIIERLVEPDRIFTFR
VTWVDDKGEVQTNLGYRVQFNNAIGPYKGGIRFHASVNLSILKFLGFEQTFKNALTTLPM
GGGKGGSDFSPRGKSDAEIMRFCQAFMLELWRHLGPDMDVPAGDIGVGGREVGYMFGMYK
KLTREFTGTFTGKGLEFGGSLIRPEATGFGGLYFVNQMLQTKGIDIKGKTVAISGFGNVA
WGAATKATELGAKVVTISGPDGYIYDPNGISGEKIDYMLELRASGNDIVAPYADEFPGST
FVAGKRPWEVKADIALPCATQNELNGEDAKNLIDNNVLCVGEISNMGCTPEAIDLFIEHK
TMYAPGKAVNAGGVATSGLEMSQNAMHLSWSAAEVDEKLHSIMHGIHAQCVKYGTEPDGY
INYVKGANIAGFMKVAHAMMGQGII
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaaaaaatcatgtcctctcttgaggcaaaacatcccggtgaatctgaatat
cttcaggccgtaaaagaagtattactctctatcgaagatatctacaaccaacacccagaa
tttgaaaaggccaaaatcatcgaaagactggtagagcccgaccgtattttcacattccgt
gtaacatgggtggatgataaaggtgaagttcagaccaacctgggatatcgtgttcagttc
aacaacgctatcggcccatacaaaggcggtatccgtttccacgcttctgtcaacctctcg
atcctgaaattcctgggattcgaacagactttcaaaaatgcactgacaactttacctatg
ggcggtggcaaaggaggttccgacttctctccacgaggaaaaagtgatgcggaaatcatg
cgtttctgtcaggcattcatgcttgaattgtggcgtcatctagggccggatatggatgtg
cctgccggtgatatcggtgtaggaggacgtgaagtcggctatatgttcggtatgtacaag
aaactgacccgtgagtttacaggaactttcacgggtaaaggacttgaatttggcggttca
ctgattcgcccggaagccactggattcggcggattgtatttcgtcaaccaaatgttgcag
accaagggtatcgacataaaaggtaaaactgtggctatctccggattcggaaacgttgcc
tggggagctgctaccaaagctaccgaactgggagccaaagtagttaccatctccggaccg
gacggatatatctatgatccgaatggaatcagtggagagaagatcgattatatgcttgag
ttgcgtgcttcgggcaacgatattgtggctccgtatgcagatgaatttccgggttctaca
ttcgtagccggtaaacgcccatgggaagtaaaagcagacatagcgcttccttgcgccact
caaaacgaattgaatggcgaagatgccaagaacctgatcgacaacaacgttctttgtgtc
ggagagatctccaatatgggttgtacacccgaagctatcgatctctttatcgaacacaaa
acaatgtacgctcccggcaaagctgtcaatgcaggcggtgtggcaacatccggactcgaa
atgtcacaaaatgcaatgcacttgagctggagtgcagccgaggtagacgagaaactgcat
tctatcatgcacggcattcatgcacaatgtgtgaagtatggtacagagcccgacggatat
atcaattatgtaaaaggtgccaatattgcaggtttcatgaaagtagcccatgcaatgatg
ggacaaggaatcatctga

DBGET integrated database retrieval system