KEGG   Bacteroides fragilis NCTC9343: BF3452Help
Entry
BF3452            CDS       T00239                                 

Gene name
rfbC1
Definition
LPS biosynthesis dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BF3452 (rfbC1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BF3452 (rfbC1)
Enzymes [BR:bfs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BF3452 (rfbC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4077506..4078048)
Genome map
AA seq 180 aa AA seqDB search
MNVIKTAIDGVVILEPRIFKDDRGYFFESFNQREFEEKVCKTTFVQDNESKSSYGVLRGL
HFQQAPFAQSKLVRVVKGAVLDVAVDIRKGSPTFGQHVAVELTEDNHRQFFIPRGLAHGF
SVLSEEVVFQYKCDNFYAPHSEGAITWDDPDLGIDWRIPADRVILSEKDSRHPRLKDLNL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaataaagactgctatcgatggggttgttatcctcgaaccccgtatttttaaa
gatgaccggggatatttctttgaatcttttaatcagagggagtttgaggaaaaagtatgc
aagactacatttgtccaagataatgaaagtaaatcgagttatggtgtacttcgtggttta
cattttcaacaggccccttttgctcagagtaaattggtgcgtgtagtgaaaggagcggta
ttggatgtagctgttgatatccgtaaaggatctcctacatttggacaacatgtggcagta
gagttgacggaggataatcatcgtcaatttttcattccccgtgggttggcacatggattc
agtgtattgagcgaggaagtcgtttttcagtataagtgtgataatttttatgctccgcat
agtgagggtgccattacctgggatgatccggatttgggtattgactggcgtattccggca
gatcgtgtgattctctcggagaaggacagcaggcatccccggttgaaagatttaaattta
tga

DBGET integrated database retrieval system