KEGG   Bacteroides fragilis NCTC9343: BF3480Help
Entry
BF3480            CDS       T00239                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BF3480 (ruvA)
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BF3480 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4102982..4103587)
Genome map
AA seq 201 aa AA seqDB search
MIEYIKGEIAELSPATAVIDCNGLGYAVNISLNTYSAIQGKSSCKLYIYEAIREDAYVLY
GFADKQERELFLLLISVSGIGGNTARMILSALSPAELVNVISTENANMLKTVKGIGLKTA
QRVIVDLKDKIKTGAMAATAVGGAAGALLPAMNAEVQEEAIAALTMLGFAAAPSQKAVLA
ILKEEPDAPVEKVIKLALKRL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatacatcaaaggcgaaattgccgaactgagtccggcaaccgcagttatcgat
tgtaacggattaggatatgccgttaatatatcactcaacacttattctgccattcagggt
aagagcagttgtaaactctatatctacgaagccatccgcgaagatgcttacgttttatat
ggctttgccgacaagcaggaacgggaacttttcctgctgctgatttccgtttcgggtatt
ggaggaaacacggcccgtatgattctttctgctctttcaccggccgaactggtgaatgtg
atcagtaccgaaaatgccaatatgctgaagacggtgaaaggtatcggactgaagaccgca
cagcgtgtcattgtcgatttgaaagataaaattaaaaccggtgccatggctgcaactgcc
gtgggaggtgctgccggtgctttgttgccggcaatgaatgcggaagtacaggaagaggcc
atcgctgcattgaccatgctcggatttgccgctgcaccttcacagaaggcggtgcttgcc
atattgaaagaagaacccgatgctccggtggagaaagtcattaagctggctttaaaaaga
ctttga

DBGET integrated database retrieval system