KEGG   Bacteroides fragilis NCTC9343: BF3537Help
Entry
BF3537            CDS       T00239                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF3537 (pfkA)
   01230 Biosynthesis of amino acids
    BF3537 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3537 (pfkA)
   00030 Pentose phosphate pathway
    BF3537 (pfkA)
   00051 Fructose and mannose metabolism
    BF3537 (pfkA)
   00052 Galactose metabolism
    BF3537 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BF3537 (pfkA)
Enzymes [BR:bfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BF3537 (pfkA)
Protein phosphatases and associated proteins [BR:bfs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BF3537 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4160751..4161731
Genome map
AA seq 326 aa AA seqDB search
MGTVKCVGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYRGLVTGEIKEFKSQNV
SNIIQLGGTILKTARCKEFTTPEGRKMAYDNMVKEGIDALVVIGGDGSLTGARIFAQEYD
IPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDAGFL
ALNGAIASGAEAAIIPEFSTEVDQLEEFIKSGFRKSKNSSIVLVAESELTGGAMHYAERV
KNEYPQYDVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEDQRNVMIGIEHDEIVY
VPFSKAIKNDKPVKRDLVNVLRELSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagttaagtgtgttggtattttaacttccggtggtgatgcaccgggaatgaac
gctgctattcgtgcagtaacgcgtgcagcaatctacaacggactgcaagtaaaaggtata
tatagaggatacagaggcttggtaacaggagagatcaaggagtttaagagccagaatgta
agtaacatcattcaactgggaggaacgatcctgaagacagcacgttgcaaagagtttaca
actcccgaaggacgtaaaatggcatacgacaatatggtgaaagaaggaatcgatgccctt
gtagtgatcggtggcgacggttcgctgaccggagcacgcatctttgcacaagagtatgac
attccatgcatcggacttccgggaaccatcgacaatgacctttacggcaccgacacgacc
atcggatacgatacggcgctgaacactattttggatgctgtcgacaaaatccgtgacacg
gccacttctcacgaacgtctgttcttcgttgaagtgatgggacgtgatgccggtttcctg
gcattgaacggtgcgattgcttccggagcagaagctgccatcatccccgaattcagtaca
gaagtcgaccaattggaagaatttataaagagcggtttccgtaaatcaaagaacagcagt
atcgtactggtagccgaaagcgaactcaccggaggagctatgcattatgccgaacgcgtg
aaaaacgaataccctcaatacgacgtccgtgtcaccattttagggcacttgcagcgcggg
ggtagtccgacggcacacgaccgtattttggccagccgtctaggcgcagccgctatcgac
gctattatggaagatcaacgaaatgtcatgattggcattgaacacgacgagattgtatac
gttccgttcagtaaagccatcaagaatgataaacctgtcaagagagatctcgtcaatgta
ttgagagaactgtctatttga

DBGET integrated database retrieval system