KEGG   Bacteroides fragilis NCTC9343: BF3540Help
Entry
BF3540            CDS       T00239                                 

Definition
membrane dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bfs  Bacteroides fragilis NCTC9343
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4163904..4164665)
Genome map
AA seq 253 aa AA seqDB search
MSIESFNLLLLVMGLVALVVFIALYFVRAGYGMFRSRSWGISVNNKIAWILMEAPVFLVM
GWLWWHSDRRFLPVELTFFLFFQLHYFQRAFVFPFLMKGKSKMPVLILLMGVIFNILNGL
MQGEWIFYLAPSDYYTPGWLLTPCFWIGTLLFFAGMGINWHSDSVIRHLRAPGDTRHYLP
QRGMYRYVTSANYLGEIVEWVGWAILTWSLSGCIFAWWTVANLVPRADAIWHRYREEFGT
QVGLKKRIFPFLY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaaagctttaatctgcttcttttagtaatgggcctggtggctttggtcgta
ttcatagccctttattttgtcagggcgggatatggcatgtttcgcagccgttcctgggga
atctcggtgaataataagatagcctggattctgatggaagctcctgtctttctggttatg
ggatggttgtggtggcattccgaccgacgttttttacctgtcgaactcactttctttctt
tttttccaactacattacttccaaagggcttttgtttttcctttcctgatgaaaggaaag
agcaagatgccggtactcattcttttgatgggagtgatctttaatattctcaacggactg
atgcagggagaatggatattctatcttgctccctcggactattatacacccggatggttg
ctgactccttgcttttggataggaacccttttattttttgccggaatggggatcaactgg
cattcggattcagtcatccgtcatctgcgtgctcccggagatacccgtcattaccttcct
caaagaggcatgtatcgatatgtgacctctgccaattatttgggtgaaattgtagagtgg
gtaggctgggctattctcacttggtctttgtccggatgtattttcgcctggtggactgtt
gccaatcttgttccgagagcagatgctatctggcatcgctatcgggaagagtttgggacg
caggtcggattgaagaaacgaatttttcctttcttatattaa

DBGET integrated database retrieval system