KEGG   Bacteroides fragilis NCTC9343: BF3611Help
Entry
BF3611            CDS       T00239                                 

Definition
glycosyl hydrolase lipoprotein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfs00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bfs00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4262202..4264508
Genome map
AA seq 768 aa AA seqDB search
MTKPSYKQWIAACTLTSTLLLGACGSAPVTRDASIVPLPNQIQQSGNAFVLTPNTTIGTT
DPELQPAAQYLKEILSAATGYDLQVKEGKGTITLAKANIEGKEGAYTLSAKSDRIDITGN
SYGGVIAGIESLRQLFPPQIESKQIVDSVAWAIPTAEIQDAPRFEWRGIMLDVSRHFYTK
EEVKELLDLMALYKMNKFHWHLTDDQGWRIEIKKYPLLTEKGAWRTFNSHDRSCMKSAKS
EDNPDFLIPENKLRIIEGDTLYGGYYTQEDIKEVIEYAKVRGIDIIPEIDMPGHMLAAVS
NYSGVACTDKVGWGTTFSSPVCPGKESAMEFCKNVYSELIDLFPYKYVHIGGDEVEKANW
KKCPDCQKRMRDNHLKTEEELQSWFIHDMEKFFNAKGKEMIGWDEIIEGGLSPTATVMWW
RSWAKDAPAKTTQQGNSIIFTPNGQFYLDYQEDKNSVRNIYNFNPAIEGLTSEQQALVKG
VQGNIWCEWIPSRERMQYMAVPRLLAIAELGWSQPSQKNWNDFAQRMANQFERLNIMGIN
YRIPDLEGFHRNNAFIGEGTVKVTCLDPNAEIHYTTDGSTPTLQSPKYEGPIQVKETTDF
TFRTFRPNGKAGDISRTRFIKSEYAPATTVTPSAKGLQAEWYEFKGNKCADITKAPLNGT
YPIEKVMIPEKAKGNIGLVIKGFINVPKDDIYTFALLSDDGSTLVIDGEQVIDNDGPHGP
REVIGQKALSKGYHPIEVRYFDQNGGQLKMTVTGTEGNEIPTSDLYAN
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccttcttacaaacagtggatagcagcctgtactctcacgagtacattgcta
ttgggagcttgcggttccgctcccgttaccagagacgcatcaatcgtaccgttgcctaac
caaattcaacaatccggcaacgcttttgtactaaccccgaacactacaatcggtaccacc
gacccggaattacagccagccgcccaatacctgaaagaaattctttcggccgccacgggc
tacgaccttcaggttaaagagggcaaggggacaatcactcttgcgaaagccaacatcgaa
ggaaaagaaggtgcctatacactttcggcaaaatcagaccggatagacatcacaggcaac
tcttatggaggggtgatagccggtatcgaatcgcttcgccagttattcccaccgcaaatc
gaatccaaacaaatcgtagacagtgtggcatgggccattcccacggcagagattcaagac
gccccccgattcgagtggcgcgggattatgctcgatgtatcccgtcacttctacaccaaa
gaggaggtaaaagaattactcgacctgatggcactctacaaaatgaataagttccactgg
catctgacagacgatcaaggttggcgcatcgaaataaaaaaatatccgttactgacggag
aaaggcgcatggcgtacctttaattcacacgacagatcgtgtatgaagtccgctaaatca
gaagacaatccggattttctgattccggaaaacaaactccgcatcatcgaaggcgacaca
ttatatggcggatactatacgcaggaggatatcaaagaagtgattgaatatgccaaagta
cgcgggatagatatcattcccgaaattgacatgccgggacatatgttggctgctgtcagc
aactattccggagtagcctgtaccgataaagtaggctggggaaccactttctcctcaccc
gtctgccccggaaaagaatcggcaatggaattctgtaagaatgtatatagtgaactgatc
gacctgtttccctacaaatatgtacacatcggaggagatgaagttgaaaaagcaaactgg
aagaaatgtcccgattgccagaaacgtatgcgggataatcatctgaaaaccgaagaagag
ctgcaatcctggtttatccacgatatggagaaatttttcaatgcaaaggggaaagagatg
atcggctgggacgaaatcatcgaaggcggactgagcccgacggctaccgtaatgtggtgg
agaagctgggcaaaagatgctcccgcaaagacaactcaacaggggaactccatcattttc
actccaaacggacagttctatctggattatcaggaagacaaaaactctgtacgcaatatt
tataacttcaatccggcaatcgaaggattgacttccgaacaacaggcattagtcaaaggc
gtacaaggaaacatctggtgtgaatggattccttcacgcgaacgcatgcagtatatggct
gttccacgcttgctggctattgccgaactgggttggagccaaccctcacaaaagaactgg
aatgactttgcacaacgcatggcaaaccaattcgaacgcctcaacatcatgggtatcaat
tatcgcatccccgacttggaaggcttccatcgcaacaatgcttttatcggtgaaggaacc
gtaaaggtaacctgcctcgatcccaatgccgaaattcattatacgacggacggcagcact
cctactctgcaatcgcctaaatacgaagggcctattcaagtaaaagaaacaacggacttt
acgttccgcaccttccgtcccaacggaaaagccggtgacatctcccggacacgcttcatc
aagagcgaatatgctccggctacgactgtcactccctctgccaaaggattgcaggctgaa
tggtatgagtttaaaggcaacaagtgtgcagacatcactaaagcaccgctgaacggaact
tacccgatagaaaaagttatgattcccgaaaaggcaaaaggaaatataggactggttatc
aaagggtttattaatgtgccgaaagacgatatctatacctttgcccttttgtcggatgac
ggcagtacgctggtaatagacggtgaacaggtgatcgataacgacggaccgcacgggccg
cgtgaagttatcggccagaaagcattatcgaaagggtatcatccgatagaagtacgctat
tttgaccaaaacggtggccaactgaaaatgacggtaaccggcactgaaggaaacgaaatt
ccgacaagtgacttatatgcaaactaa

DBGET integrated database retrieval system