KEGG   Bacteroides fragilis NCTC9343: BF3620Help
Entry
BF3620            CDS       T00239                                 

Definition
alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF3620
Enzymes [BR:bfs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BF3620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4274213..4276915
Genome map
AA seq 900 aa AA seqDB search
MIVTFHIEYRTSWGEEVRILGSVPELGKNNPEQAVALTTVDGIHWSNEISIQLPAEGVVE
YSYHIYRDGKAIRTEWNSFPRRIYLPADVKKSLRINDCWKNLPEQQYFYSSAFTEALLAH
RERSAIPKSYKKGLMIKAYAPRINSKYCLAICGNQKTLGNWDPDKAWPMSDANFPEWQAE
LDASKLEFPLEYKFVLYNKEEKRAEAWENNPNRYLAAPEIKANETLVIADRYAYFNIPSW
KGAGVAVPVFSLKSEKSFGVGDFGDLKRMVDWAVSTNQKVVQILPINDTTMTHTWTDSYP
YNSISIYAFHPMYADLKQMGNLKDKETAAAFNRKQKELNALSAIDYEAVNRVKWEYFHQI
FKQEGEKVLASKAFRSFFEANKDWLQPYAAFSYLRDLYHTPNFREWPQYSEYNAQEIEEL
CRPDTADYAHIAIYFYIQFNLHLQLLEATTYAREHGVVLKGDIPIGISRNSVEAWTEPYY
FNLNGQAGAPPDDFSINGQNWGFPTYNWDVMENDGYKWWMKRFQKMAEYFDAYRIDHILG
FFRIWEIPMNAVHGLLGQFVPALPMSREEIESYGLSFREEFLRPYIHEYFLGQVFGPHTD
YVKQTFIEPTETYEVYRMRPEFDTQRKVEAFFAGKNDEDSIWVRDGLYALISDVLFVPDR
KDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHNDFWQQQAMKKLPQLTQST
RMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFGRLNEYPYRSVCTFSTHDM
STLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEIVRNHLYSNSILCILSLQDWL
SMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAESLNEKIRELVKQTGRNPEK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgatagttacatttcatattgaatatcgcacaagctggggagaagaagtcagaatatta
ggttctgtccccgaacttgggaaaaataatccggagcaggctgtagcccttaccacagta
gacggcattcattggagcaatgaaatatccattcaattgccggccgaaggggttgtcgaa
tacagttatcacatataccgtgacggtaaggccatccgtaccgaatggaactcctttccg
cgacgcatctatctgccggccgacgttaagaaaagcctgcgcatcaacgactgctggaag
aatcttccggagcagcaatacttctacagttcggcatttaccgaagcactgctggcgcac
cgcgaacgaagcgcaatccccaaaagctacaaaaaaggattgatgatcaaggcttatgct
ccacgcatcaacagcaagtactgcctggccatctgtggtaaccagaaaacactcggcaac
tgggacccggacaaggcatggcccatgagtgatgccaactttccggaatggcaagccgaa
ctggatgcttccaaactggaatttccgctagaatacaaatttgtattgtacaataaagaa
gagaaacgtgccgaagcttgggagaataaccccaaccgctatctggctgctcccgaaatc
aaagcaaacgaaacgttggtcattgccgaccgatatgcctactttaatattccttcctgg
aaaggtgcaggcgtagctgtccctgtattctcactaaagtcggaaaaaagtttcggtgta
ggagacttcggagacctgaagagaatggtggactgggcggtcagtaccaaccagaaggta
gtacagatcttaccgatcaacgataccaccatgactcatacatggacagactcttatccc
tacaacagcatttccatttatgccttccacccgatgtatgccgaccttaaacagatgggc
aacctgaaggataaggaaactgcggccgccttcaaccggaagcaaaaagaactgaatgca
ctttccgccatcgactacgaagctgtcaaccgggtgaaatgggaatatttccatcagata
ttcaagcaagaaggagaaaaggtgctggcttcgaaagccttccgcagcttcttcgaagcc
aacaaagattggctgcaaccgtatgctgcattcagctacctgcgcgatttataccataca
ccgaacttccgcgaatggccccaatactcggagtacaatgctcaagagattgaagaactg
tgccgccccgacacggcggactatgcccatatcgccatctacttctatatccagttcaat
cttcacctgcaattgctcgaagccaccacttatgcccgcgagcatggagtagtgctgaag
ggggacatccccatcggtatcagtcgcaacagtgtagaagcctggacagaaccttattat
ttcaacctcaacggacaggccggtgctccacccgatgatttctctatcaacgggcagaac
tggggtttccccacctataactgggatgtgatggagaacgacggttataaatggtggatg
aaacgtttccaaaagatggctgaatactttgacgcctaccgcatcgaccacattctggga
ttcttccgcatctgggaaatcccgatgaatgccgtgcatggattgctgggacagtttgta
cccgcccttcccatgagccgtgaagagatagaaagttacggactctctttccgtgaagag
ttcctgcggccgtatatccatgaatatttcctcggacaagtgttcggaccacataccgac
tatgtaaagcagacgttcatcgaaccgactgaaacttacgaggtataccgtatgcgtccg
gaatttgatacccaacgcaaggtagaagccttctttgccggcaagaacgacgaagacagt
atatgggtcagagacggattatatgccctgatcagtgacgtattatttgttcccgaccgc
aaagacccgaacctgtaccatccccgcattggcgtgcagcacgactttatctaccgtgcc
ctgaacgactgggaaaaaacagcattcaaccgcctttacgaccagtactactatcatcgt
cacaatgacttctggcaacagcaagccatgaagaaattgccacagcttacccagtctacc
cgcatgctggtatgtggcgaagacttaggcatgattcccgactgcgtggcatgggtgatg
aatgacttacgtatcctgagtctcgaaattcagcggatgcccaagaatccggcagaagaa
ttcgggaggctgaacgaatatccgtaccgttcggtctgcaccttctccacccacgatatg
tcgaccctgcggggctggtgggaagaagactatcagcagacccaacgctactacaatcag
atgctgggacattatggtaccgctcctgccatagcaacgccggagctgtgcgaagaaata
gtacgcaatcacctttacagcaattccatcctctgcatcctatccctgcaagactggctg
tcgatggatggaaaatggcgcaacccgaatgtacaggaagaacggatcaatatccccgcc
aatccgcgtcattactggcgctaccggatgcacctgacactggaacaactgatgaaagca
gaaagcctgaatgaaaaaatcagggaattggtgaagcagacaggcagaaatccggaaaag
taa

DBGET integrated database retrieval system