KEGG   Bacteroides fragilis NCTC9343: BF3667Help
Entry
BF3667            CDS       T00239                                 

Definition
glycosyl hydrolase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF3667
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BF3667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4329335..4331644)
Genome map
AA seq 769 aa AA seqDB search
MKKLILLLILIFSLPVAAQNFTIGKSTFLLNGKPFTVKAAELHYTRIPAPYWEHRIEMCK
ALGMNTICLYVFWNIHEQTEGQFDFTGQNDIAAFCRLAQKHGMYVIVRPGPYVCAEWEMG
GLPWWLLKKKDIVLRTLDPYFMERTAIFMKEVGKQLAPLQITRGGNIIMVQVENEYGAYA
VDKPYVSAIRDIVKSAGFTEVPLFQCDWSSTFDRNGLDDLLWTINFGTGANIEQQFKRLK
EARPETPLMCSEFWSGWFDHWGRKHETRPAKSMVQGIKDMLDRNISFSLYMAHGGTTFGH
WGGANNPSYSAMCSSYDYDAPISEPGWTTDKYFQLRDLLKNYLPAGEQLPEIPEAFPVIE
IPEVEFTQIAPLFSNLPEAKESMDIQPMEAFDQGWGTILYRTTLQEPVENGTTMKITEVH
DWAQVFADGKLLARLDRRRGEFVLQLPALKKGTRIDILVEAMGRVNFDESIHDRKGITEK
VELVRGKQSAELKNWTVYSFPVDYSFVQDKRYKNGTAQTMPAYYRTTFRLDKVGDTFLDM
STWGKGMVWVNGLAIGRFWEIGPQQTLFMPGCWLKEGENEIIVLDLKGPEKASIRGLKKP
ILDWLRNEGASTHRKEGEQLDLSRETPVAEGTFVPGNGWQEVCFDRQSIGRYFCLEALSA
QKGKKIAAIAELDVLGADGKPISREKWRIRYADSEETRSGNCTGDKVFDLQESTYWMTVA
KDAYPHQLVIDLGGDYTVTGFRYLPRAEKGYPGMIKDYRVYVKGEDFQY
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgattctgcttctcattttgattttttcattgcctgttgcagcacaaaat
ttcacaatcgggaagagcactttccttttgaatggcaagccttttacggttaaggctgcc
gagttgcattatacccgtattccggctccttactgggagcatcgtatcgagatgtgtaag
gcattggggatgaatacgatttgtctttatgtattttggaacatccatgaacagactgag
ggacagtttgactttaccggacaaaatgatatagccgctttttgccgcctggctcagaag
catgggatgtatgtgattgtacgcccgggtccttatgtttgtgccgaatgggagatgggc
ggacttccttggtggttactgaagaagaaagatattgtacttcgtacactcgatccttat
tttatggagcgcactgcaatctttatgaaagaagtcggaaaacagcttgcacctttgcag
attactcgcggaggaaacattatcatggtgcaggtagaaaatgaatatggtgcttatgca
gttgacaaaccctatgtttcggctattcgtgatatagtgaaaagtgccgggtttaccgaa
gttcctctttttcaatgtgactggagcagtacctttgatcggaatggattggacgatttg
ctctggactatcaattttggtacgggagccaacattgaacagcagttcaagcgtctcaaa
gaggctcgtccggagactccattaatgtgtagtgagttctggagtggatggtttgatcat
tggggacgcaagcatgagacccgtcctgccaaaagcatggtgcagggtatcaaagatatg
cttgaccgtaatatttcattcagtctctatatggcccatggaggtactactttcgggcat
tggggtggtgccaacaatccgtcttactccgctatgtgtagttcttacgattacgatgcg
cctatcagtgagccgggatggactacggacaaatatttccagcttcgtgatctgctgaaa
aattatctgcctgcaggagaacaattgcctgagattcccgaagcttttccggtgattgag
atacctgaagtggagtttactcagattgctcctctcttttccaatttgcccgaggctaaa
gagagtatggatatacaaccgatggaggcttttgatcaggggtggggaacgattttgtat
cggactactttgcaggagcctgtcgaaaatggcactacgatgaagatcacagaagtacat
gattgggcacaagtttttgccgatggtaaattgttggctcgtctggaccgtcgtcgtggt
gaatttgtcttgcaactgccggctttgaagaaaggaacgcgtatcgacatcctggtagaa
gctatgggacgcgttaactttgatgagtcgattcacgatcgcaaaggtatcactgaaaaa
gtagaacttgtccgtggaaagcaatctgcagagttaaagaattggacggtttatagtttt
ccggtggattattcgtttgtgcaagataaaagatataaaaatgggacagctcagactatg
cctgcgtattataggactaccttccgtttggataaagttggcgatacgttccttgacatg
agtacttggggtaaaggtatggtatgggttaatggccttgctatcggacgtttctgggag
attggtccgcagcagacactcttcatgcccggttgttggctcaaagagggagaaaatgaa
attattgttcttgatttgaaaggccctgagaaagcatctatccgcggactgaagaagccc
atcttggattggttacgcaatgaaggggcttctacccatcgcaaagagggtgaacaactg
gacttgagtcgggaaactcccgttgccgaaggtacgtttgttccgggcaacggatggcag
gaagtttgctttgatcgtcagagtatcggtcgttatttctgccttgaggccctttcggca
caaaaaggaaagaagatagcagccatcgccgaacttgatgtactgggtgccgacggtaag
ccaatttcacgtgaaaagtggagaatacgctatgccgacagcgaagagacacgtagcggt
aactgtacgggagataaagtgtttgaccttcaggaatccacttactggatgacggtggct
aaagatgcttatcctcatcaattagtcatcgatctgggtggagactataccgtaaccggt
ttccgctatttgccccgtgccgaaaagggatatcccggcatgataaaagattaccgggtg
tacgtcaaaggggaagattttcaatactga

DBGET integrated database retrieval system