KEGG   Bacteroides fragilis NCTC9343: BF4183Help
Entry
BF4183            CDS       T00239                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF4183
   00052 Galactose metabolism
    BF4183
Enzymes [BR:bfs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BF4183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4944349..4945479
Genome map
AA seq 376 aa AA seqDB search
MKTKLIILLILTTMIHTNTVNAQHSQLKRADFQQTIDGKQTDLYFLRNKNGIEIAITNFG
GRVVEFWTPDKKGHFEDIVLGHDHVDKYLHYKGERFLGATIGRYGNRINKGKFTLNGQTY
QLPINDTPNSLHGGFKGFDMVVWDVEQPDSQTLQLTYLSKDGEEGYPGNLQVSMNYKLTD
KNEFIITHQAQTDKETVINLTHHSFFNLHGAGNKDINDHILMINADKFTPVDRTLIPTGI
LQDVEGTPMDFRRPTPIGKRVNDSFEQLEFGHGYDHNWVLNRKTSNTPELAATVYEPASG
RYLEVWTTEPGLQFYGGNFFDGTMTGKHEKKYNYRASLALETQHYPDSPNQPAFPSTTLL
PGDTYKHICIYKINVQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaactgatcattttattaatactcacaaccatgatacacacaaacaccgta
aatgcccaacattcacaattgaaaagagccgattttcaacaaacaattgacggaaagcaa
accgatctctactttctgagaaacaaaaacggcattgaaattgccatcaccaatttcgga
ggacgagtcgttgaattctggactccggataaaaaagggcattttgaagacatcgtcctc
ggacacgatcatgtggacaaatatctccattataaaggtgaaagatttttgggagccact
atcggacggtatggcaaccggatcaacaaaggaaagtttaccctgaacggacaaacttac
cagttacccatcaatgatactcccaacagtctacatggtggctttaaaggatttgatatg
gtagtatgggatgttgagcagccggacagccagactttacaactcacgtatttatccaaa
gatggtgaagaggggtatccgggaaatctccaagtatccatgaattacaagcttacggat
aaaaacgaatttattatcactcaccaggctcaaacagacaaagaaacggtcatcaacctc
acccatcattccttcttcaacctgcacggtgcaggcaataaggatatcaatgaccatata
ctcatgatcaatgcggataagtttactcctgtcgatcggaccctaatccccaccggtatt
ctccaggatgtagaagggaccccgatggattttcgtcgccccacacctatcggaaagcga
gtaaatgattcgttcgagcaactagagttcggtcacggctacgaccataattgggtattg
aatcgcaaaacctccaacacccccgaactggcagcaaccgtttatgaacccgcctcagga
agatatcttgaagtatggaccaccgaacccggactacaattctatggcggtaacttcttt
gatggtacaatgaccggaaagcacgaaaagaaatacaactaccgggcttccctcgcattg
gaaacccagcactatccggatagtcctaaccaaccggcattcccgtcaacaaccctctta
cccggagatacttacaaacatatatgcatctataaaatcaatgtacaatga

DBGET integrated database retrieval system