KEGG   Bacteroides fragilis NCTC9343: BF4189Help
Entry
BF4189            CDS       T00239                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfs00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bfs00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bfs00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4950432..4951922)
Genome map
AA seq 496 aa AA seqDB search
MKITSYVSFLYCLCLMLASPTVQASEVRTAIFEGKPCINPPHVVGNYPATPFLFYIPTSG
ERPIKWHAENLPKGLKLDKETGIIKGKVVEKGTYKVMLKAENALGTDTQELLINIGDELL
LTPPMGWNSWNTFGRHLTEELLLQTADAMVENGMRDLGYAYINIDDFWQLPERGADGHIQ
IDKTKFPRGIKYVADYLHERGFKLGIYSDAADKTCGGVCGSYGYEEIDARDFASWGVDLL
KYDYCNAPAGRVEAMERYEKMGRALRATDRSIVFSICEWGQREPWKWAKKVGGHLWRVSG
DIGDLWNRSTDEKGGLRGILNILEINAPLSEYARPGGWNDPDMLVVGIGGKSKSIGYESE
GCTNEQYQSHFALWCMMASPLLCGNDVRQMNDSTLQILLNKDLIAINQDPLGIQAERAIR
ADHYDVWVKPLSDGSKAIACLNRISGPVDVELNVKTVEGLSLDRVYDVIEGSLVAEASTG
WVVKLAPGECKVFICK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacaagttatgtttcttttttatattgcttatgtctgatgctggcgagtccg
acagtacaggcgagcgaagtgcgaaccgctatttttgaggggaaaccgtgtattaatccc
cctcatgtggtgggaaactatcctgctaccccttttttgttttatattcccacctccgga
gaacgaccgataaagtggcatgctgaaaatcttcccaagggattgaagctggataaagaa
acggggataatcaagggaaaagtagtagaaaagggaacgtacaaagtaatgctgaaagct
gagaatgcccttggaaccgatacacaggaactactgattaatataggagatgagttgttg
ctgactcctccgatggggtggaacagttggaatacattcggacgtcacctgacagaggag
ctactgttgcaaactgcagatgcaatggtagaaaacggaatgcgtgatttggggtatgct
tatattaatatcgatgacttttggcagttgcctgaaaggggagctgacggtcatatccaa
attgataaaacaaagttcccgagaggcatcaaatatgtggccgattacttgcatgagcga
ggattcaaacttggaatttattcggatgccgctgataaaacttgtggtggggtttgtggc
agttatggatatgaagaaattgatgcacgggatttcgcatcctggggtgttgatcttttg
aagtatgactattgcaatgcacctgccggaagagtagaagcgatggaaagatatgagaag
atggggagggcattgagagcgaccgaccgttctatcgtcttttcaatttgtgagtgggga
cagcgtgaaccttggaaatgggcgaagaaagtcggcggacatttatggcgagtatccggt
gatattggcgacttgtggaatcgttcgacagacgaaaagggaggtttacgtggcattttg
aacattcttgaaataaatgcaccgcttagtgaatatgcaagacccggcggatggaatgat
ccggatatgcttgttgtggggattggcggaaaaagtaagagtatcggttatgaatcggaa
ggttgtacgaatgaacaatatcagtcccactttgctctctggtgcatgatggcttctcca
ttactctgtggcaatgatgtacggcagatgaatgatagtacgttacaaatacttttgaat
aaggatctgattgctatcaatcaggatccgctgggcattcaggcagagcgtgccattcgt
gccgatcattatgatgtctgggtgaagccgttgagtgacggaagcaaagcaatagcttgt
ctgaaccggatatccggacccgtagacgtggagttgaatgtaaagacggtagaaggattg
tcattggatcgggtatatgatgttatagaaggcagccttgtggctgaggcttctaccgga
tgggtcgtaaagcttgctcccggtgagtgtaaagtgtttatatgtaaataa

DBGET integrated database retrieval system