KEGG   Botryotinia fuckeliana: BC1G_00062Help
Entry
BC1G_00062        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
bfu  Botryotinia fuckeliana
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:bfu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 258 aa AA seqDB search
MAAVAAQAPTGEQVDLSTIPVSPEGASNSNENTKPVAEGDQITVFHDKDNFNVKHPLTNK
WTLWFTKPPSGKGDNWNDLLKEVITFNSVEEFWGVYNNIAPTSELALKSDYHLFKEGVRP
EWEDQQNKHGGKWSYQFKEKRNVPIDELWLHVMLAAIGETLEDEDDGEVMGVVVNVRKGF
YRVGVWTRTIGKSIPGGGDGNGAGGKGRSAEKGKEVLMNIGKKFKEVLKLPASEAVEFSG
HTDSAHSGSTRAKAKHSV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtcgcagcacaagcaccaactggtgaacaagttgacttgtcaaccattcca
gtctcgcctgaaggggccagcaattcaaatgagaacaccaagccagtcgcagagggtgat
caaattaccgttttccatgataaggataacttcaacgtcaagcatcctttgacaaacaaa
tggactttgtggttcacaaagccacccagtggaaagggtgacaactggaacgatctcttg
aaagaggttatcaccttcaactctgttgaggaattttggggcgtatacaacaatatcgca
ccaacatctgaactcgccctcaaatctgactaccatttgttcaaggaaggtgttcgaccg
gaatgggaagatcaacaaaacaagcacggtggaaaatggtcatatcaattcaaggaaaag
cgcaatgtccctattgatgaactttggcttcacgtcatgttggcagctattggagagact
ctcgaagatgaagacgacggagaggttatgggtgttgttgtcaacgtcaggaagggtttc
taccgtgttggtgtctggactcgcacaattggcaagagcattcccgggggtggagatggc
aatggtgctggaggaaagggaagatccgccgaaaagggcaaagaagttctgatgaacatc
ggcaaaaagttcaaggaagtcttaaagctcccagcatctgaggcagttgaattctctggc
cataccgatagtgcacacagtggaagtactcgcgcgaaggctaagcattcagtctag

DBGET integrated database retrieval system