KEGG   Botrytis cinerea: BC1G_00062Help
Entry
BC1G_00062        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
bfu  Botrytis cinerea
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BC1G_00062
Translation factors [BR:bfu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    BC1G_00062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 258 aa AA seqDB search
MAAVAAQAPTGEQVDLSTIPVSPEGASNSNENTKPVAEGDQITVFHDKDNFNVKHPLTNK
WTLWFTKPPSGKGDNWNDLLKEVITFNSVEEFWGVYNNIAPTSELALKSDYHLFKEGVRP
EWEDQQNKHGGKWSYQFKEKRNVPIDELWLHVMLAAIGETLEDEDDGEVMGVVVNVRKGF
YRVGVWTRTIGKSIPGGGDGNGAGGKGRSAEKGKEVLMNIGKKFKEVLKLPASEAVEFSG
HTDSAHSGSTRAKAKHSV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtcgcagcacaagcaccaactggtgaacaagttgacttgtcaaccattcca
gtctcgcctgaaggggccagcaattcaaatgagaacaccaagccagtcgcagagggtgat
caaattaccgttttccatgataaggataacttcaacgtcaagcatcctttgacaaacaaa
tggactttgtggttcacaaagccacccagtggaaagggtgacaactggaacgatctcttg
aaagaggttatcaccttcaactctgttgaggaattttggggcgtatacaacaatatcgca
ccaacatctgaactcgccctcaaatctgactaccatttgttcaaggaaggtgttcgaccg
gaatgggaagatcaacaaaacaagcacggtggaaaatggtcatatcaattcaaggaaaag
cgcaatgtccctattgatgaactttggcttcacgtcatgttggcagctattggagagact
ctcgaagatgaagacgacggagaggttatgggtgttgttgtcaacgtcaggaagggtttc
taccgtgttggtgtctggactcgcacaattggcaagagcattcccgggggtggagatggc
aatggtgctggaggaaagggaagatccgccgaaaagggcaaagaagttctgatgaacatc
ggcaaaaagttcaaggaagtcttaaagctcccagcatctgaggcagttgaattctctggc
cataccgatagtgcacacagtggaagtactcgcgcgaaggctaagcattcagtctag

DBGET integrated database retrieval system