KEGG   Botrytis cinerea: BC1G_00111Help
Entry
BC1G_00111        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfu  Botrytis cinerea
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BC1G_00111
  Lipid metabolism
   00561 Glycerolipid metabolism
    BC1G_00111
   00600 Sphingolipid metabolism
    BC1G_00111
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    BC1G_00111
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BC1G_00111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 504 aa AA seqDB search
MGFNNWSAFMCGLNESLFVETAQAMVEKGLLAAGYNRLNLDDCWSQGSREPNGSLLWNTE
KFPRGLPWLTGYLKSLGFDSGIYTDAGINSCGGYPGSYGYEELDSRAFASWGFDYLKVDG
CNMPVATEQEYERVYGHWHSVLSALEKPLIFSESAPAYFAEQDNLTDWYTVMDWVPKYGQ
LARHSRDTLVWNSTSYWPDITGWDSILFNYGQEVRLARYQKPGYFNDPDFLIVDHFDLSL
NEKRSHFAIWASLSAPLIISAYIPAFSADEVAYLTNKDLIAVNQDPLALQATLVSQDGTW
DVLTRDLANGDRLLTVINRGNLTASYKVPFQRIGISASAVKVKDLWTGKLSTTSKVVTAV
NIPSHGTAVYRISAGYGNLNVIPTGMIFNTASLNVLTYSRQGLAWVASLGSDEQVWQTDE
DGTIKGVFDTSKCLTDLGGGKVSLVACSGEKNQRWEYYVTGNLVSLSTGACLAEASGDVV
TAKCQFESNGQVLGLPSGIDVIGQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcaacaattggtccgcatttatgtgcgggcttaacgaatcgctattcgttgag
acagcccaggcaatggtggagaaaggcctactcgcagcaggttacaatcgacttaatcta
gatgattgttggagtcagggcagccgagaaccgaacggtagtctattatggaacaccgag
aagttcccacgcggtcttccatggttgactggctatttaaaaagcctgggttttgattcc
ggaatctataccgatgctggtatcaattcttgtggaggatatccaggttcgtatgggtat
gaggagcttgattctagagcttttgcttcgtggggctttgattaccttaaggttgatggt
tgcaacatgcctgtagcaaccgagcaagagtatgagcgtgtttacggacattggcatagt
gtcttgagtgcattggagaaacctctcatcttttcagagtctgccccagcatactttgca
gagcaggacaatctaaccgattggtatactgtgatggattgggttccgaaatacgggcag
cttgctcgtcactcgcgtgatacactggtctggaactcaacttcatattggcccgacatc
accggatgggattctatcttattcaactatggacaggaagtaagattggcgcgatatcag
aagcctgggtactttaacgacccggatttcttgattgttgaccacttcgacttgtcgctc
aatgaaaagaggtcacatttcgctatctgggcttcactatccgcccctcttattatcagt
gcctatattccggcctttagcgcagatgaagttgcttatctcacgaacaaagatttaatt
gcagtgaaccaagatccattggctttacaggctacacttgtcagccaagatggcacatgg
gatgttttaaccagagatctggcaaatggggaccgacttctcactgttatcaatcgagga
aatctcacagctagctacaaagtaccatttcaaaggattggtatctctgcatcagcagtc
aaagtcaaagatctctggaccgggaaactctcaaccacatccaaagtagtcacagctgtc
aatattccttcgcacggtactgcagtatatcgcatttctgctgggtatggaaatctaaac
gttataccgactggtatgatttttaacacagcatcactgaatgttcttacctactctcgt
caaggcctagcgtgggtagcctctctcggatcggacgagcaagtgtggcaaacagatgag
gatggtactattaagggggtatttgatacttctaagtgtctaacggatctcggaggcgga
aaggtatcactggttgcatgttctggtgaaaagaatcagagatgggagtactatgttact
ggaaatctcgtgagcctcagtactggggcgtgtttggccgaggctagtggagatgttgtg
acggcgaaatgtcaatttgaaagcaacgggcaagtgcttggtttgcccagtggaattgat
gttattgggcagtaa

DBGET integrated database retrieval system