KEGG   Botryotinia fuckeliana: BC1G_00266Help
Entry
BC1G_00266        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
bfu  Botryotinia fuckeliana
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfu00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 324 aa AA seqDB search
MDRPKKPSALSATPGLAPHAQINTTHSNSRVSAVLPTGESVEILLYGATIISWKDAAGTE
KLWLSEKAALDGTKAVRGGIPLVFPVFGKVEGEEGKAKGVDTLPQHGFARNCRWEFLGKS
TSESSTTKGGDSSVKLDFGLSASNLPDETRKLWGGEFGLIYSVTLGREGLATSMVVRNEG
STAWEFQILMHTYLKIQDISQISITGLENATYVDKLTEPISTNTAPTDPLTISAKTDRVY
TPAGGPSTEIIVSEGGKKKYTVARDNMNQVVVWNPWIDAKDIGDFAPKDGWRTMICVEAG
SVSGWQKLEAGETWEGGQIITIAN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaccgacccaagaagccatctgctctctctgccactccaggcctcgcaccacacgcc
caaataaatactactcattccaattcccgtgtctccgccgttctccccaccggcgaatca
gtcgaaatccttctttacggcgccacaatcattagctggaaagatgctgccggaaccgaa
aaactttggctcagcgaaaaagcggcgctcgacggtacaaaggctgtgcgtggtggtatc
cctctagtattcccggtgttcggaaaggtagagggcgaggaaggtaaagcgaagggtgtc
gatactttacctcaacatggttttgcgcgcaattgtagatgggagtttttgggaaagagc
actagtgagagcagcactactaagggtggtgatagcagtgtgaagctggactttggtttg
agtgccagtaatttaccggacgagacacgaaagttgtggggtggcgagtttgggttgatt
tatagtgttacgctcggcagagaaggtcttgcgactagcatggtggttagaaatgagggt
agtacagcttgggagttccagatcttgatgcacacttatttgaagatccaggatatctcc
caaatctccatcacaggtctcgagaatgctacatatgtcgacaaactcaccgaaccaatt
tctacaaacaccgctccaaccgatcctctcaccatctctgccaaaaccgatcgtgtttac
actcctgccggcggtccatccactgaaataatcgtttccgagggaggaaaaaagaaatac
acagtcgcgagagataacatgaaccaagttgtcgtttggaacccttggatcgacgccaag
gatatcggcgattttgctccaaaagatggatggagaaccatgatttgtgtcgaggctgga
tctgtcagtggatggcaaaaattggaggccggagagacttgggaaggtggccaaattatc
acaattgctaactag

DBGET integrated database retrieval system