KEGG   Botryotinia fuckeliana: BC1G_00351Help
Entry
BC1G_00351        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
bfu  Botryotinia fuckeliana
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:bfu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 272 aa AA seqDB search
MPDKWDEESSGEESEQTPAQTAVSNRRKFDDEEDDDEVLDSWSAAEDSEVEREKAKVEAE
RKAKADALAAANKKSKAQRVAEKQAERARQLAEGSDESSEEDEATRRERLRRTEQESDLK
HAEDLFGSIGFNSRKSTSAANAVQIDEKNPAATVDLTTLPLFDPKTKLQFEKLRETLVPL
ITNNAKKAQYIIFLQEFTKQISKELPSDQIKKIASTLTALSNEKMKEEKAAEKGGKKSKA
QKTKTTLNASRDTMGSKDTQAYDDDFGDDDFM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaagtgggatgaggaatcctccggagaggagtcggagcaaacacccgcacaa
actgccgtttcgaaccgaagaaagttcgatgatgaggaggatgacgatgaagtcttagat
tcctggagtgcggctgaagattctgaagttgagcgcgagaaagcaaaggttgaagccgag
cgaaaggcgaaggctgatgcactggctgctgcaaacaaaaagtcaaaggcccaacgtgtc
gctgagaagcaggccgagagagcacgacaactggcagaaggtagcgatgagagcagtgaa
gaggatgaggctacaagaagagaacgtctcagacgaaccgaacaagaatccgatttgaag
cacgctgaggatctttttggcagcattggtttcaactctcgcaagtctacgagtgctgcg
aacgcagtgcaaattgacgaaaagaaccccgcggcgactgtcgatttgacaaccctccca
cttttcgatcctaagaccaagctgcaatttgagaagctccgcgaaactcttgtccctctt
attaccaacaatgccaagaaagcacaatacatcatcttcttgcaagagttcactaagcag
atttccaaagaacttccaagtgatcaaatcaagaagatcgccagtacactgacggctttg
agtaacgagaaaatgaaagaggagaaggcagctgaaaagggaggaaagaagtctaaagca
cagaaaaccaagactaccttgaatgcaagcagggacactatgggcagcaaagatacccag
gcctatgatgatgatttcggagatgatgattttatgtga

DBGET integrated database retrieval system