KEGG   Botryotinia fuckeliana: BC1G_00376Help
Entry
BC1G_00376        CDS       T01072                                 

Definition
lysophospholipase precursor
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
bfu  Botryotinia fuckeliana
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bfu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 521 aa AA seqDB search
MKGFGAIVASVALSSICDARQLVLPRDASPKIVAAEVLAAPMYAVKRALPDSPTGSYTPG
AVDCPDTRPAIRNGSELSANETSWLELRRNNTIDPMITFLERMNISGFDAKSYINSVSGN
ASTLPNIGIAISGGGYRAMLNGAGFIAAADDRTANSTNSGQIGGLLQATTYLAGLSGGGW
LVGSIYTNNFSSVENLRDSSDVWNFQNSIFEGPNDDHIQILSTADYYSTIKSEVSGKADA
PLNFNTSITDYWGRALSFQLVNATDGGPAYTFSSIALQDNFANGEIPMPFLVADGRSPYT
EIISLNSTVYEFNPFELGSWDPTTYAFAPLRYIGSNFTAGSIPDGQQCVRGFDQVGYVMG
TSSSLFNQFLIQANQSSLPTIVTEAFTAILDKIGFINNDIAQYQPNPFYGFNNDTNRNAQ
TTQLDLVDGGEDGQNVPLYPLIQPIREVDVIFAIDSSADTTYFWPNGTSLVATHERSQNA
TIANGTAFPSIPGQNTFVNLGLNKRPTFFWCDPIISDSQHP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggttcggagctatagttgcttcggttgcattatcttcaatatgtgatgctcgt
caattggttttacctcgagatgcgtctcccaaaatcgtcgctgctgaagtattagctgcc
cctatgtatgctgtcaagcgtgcattgccagattcgccaacaggaagctatacaccagga
gcagtggattgtcctgacacgagaccagcaatcagaaatggcagtgaattatctgccaat
gaaacatcatggctagaattacgaagaaataacacgattgaccccatgataactttcctc
gaaaggatgaacatttctggattcgatgcaaaatcatatataaacagcgtctccggcaat
gcatctacattaccgaatatcggtatagcgatttctggaggaggctaccgtgcaatgttg
aatggtgctggattcatcgctgccgccgatgatcgaacggctaattcaacaaactcggga
caaatcggaggtcttttacaagctacaacctaccttgcaggtctatctggtggtggatgg
ttagtaggatcaatctacacgaacaactttagtagtgtcgaaaatttacgagatagttct
gacgtgtggaactttcaaaattcgatcttcgaagggcctaacgatgatcatattcagatc
ttgagtactgctgattactacagcaccatcaagagcgaggtttctggaaaagcagatgcc
cctctcaatttcaatacatcgatcaccgattattggggacgcgcattatcctttcaattg
gtcaatgctacagatggtggaccagcttatacattttcatcaattgcactccaggacaac
ttcgcaaatggcgaaattcctatgccttttctcgtcgctgacggccgttcgccatacacc
gagatcatatcactaaattcaaccgtctacgaattcaatccgtttgagcttggttcatgg
gatcctacgacatacgccttcgcaccccttcgttatattggttcaaatttcaccgctggt
tccatccctgacggtcaacaatgtgttcgtggttttgatcaagtcggctacgtgatgggt
acttcgtcctcacttttcaaccaatttttgattcaagccaatcaaagttcgcttccaact
attgtcaccgaagcgttcaccgccattcttgacaagatcggattcatcaacaatgatatt
gcgcaatatcagcctaaccccttttatggattcaacaatgataccaatcgtaatgcccaa
acgacccaattagatttggtagatggtggtgaggacggccagaacgtccctctttatcct
ctcatccaacctatccgtgaagtagatgtaatcttcgcaatcgattcatctgcggacacc
acatatttctggcccaacggaacatctctcgttgcaacccacgaacgttctcaaaatgca
accattgcaaacggaaccgcattcccctcgatccctggccaaaacacattcgtcaatctt
ggactcaacaaacgccccactttcttttggtgcgatcccatcatttcagacagccaacac
ccttaa

DBGET integrated database retrieval system