KEGG   Botrytis cinerea: BC1G_00376Help
Entry
BC1G_00376        CDS       T01072                                 

Definition
lysophospholipase precursor
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
bfu  Botrytis cinerea
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BC1G_00376
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BC1G_00376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 521 aa AA seqDB search
MKGFGAIVASVALSSICDARQLVLPRDASPKIVAAEVLAAPMYAVKRALPDSPTGSYTPG
AVDCPDTRPAIRNGSELSANETSWLELRRNNTIDPMITFLERMNISGFDAKSYINSVSGN
ASTLPNIGIAISGGGYRAMLNGAGFIAAADDRTANSTNSGQIGGLLQATTYLAGLSGGGW
LVGSIYTNNFSSVENLRDSSDVWNFQNSIFEGPNDDHIQILSTADYYSTIKSEVSGKADA
PLNFNTSITDYWGRALSFQLVNATDGGPAYTFSSIALQDNFANGEIPMPFLVADGRSPYT
EIISLNSTVYEFNPFELGSWDPTTYAFAPLRYIGSNFTAGSIPDGQQCVRGFDQVGYVMG
TSSSLFNQFLIQANQSSLPTIVTEAFTAILDKIGFINNDIAQYQPNPFYGFNNDTNRNAQ
TTQLDLVDGGEDGQNVPLYPLIQPIREVDVIFAIDSSADTTYFWPNGTSLVATHERSQNA
TIANGTAFPSIPGQNTFVNLGLNKRPTFFWCDPIISDSQHP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggttcggagctatagttgcttcggttgcattatcttcaatatgtgatgctcgt
caattggttttacctcgagatgcgtctcccaaaatcgtcgctgctgaagtattagctgcc
cctatgtatgctgtcaagcgtgcattgccagattcgccaacaggaagctatacaccagga
gcagtggattgtcctgacacgagaccagcaatcagaaatggcagtgaattatctgccaat
gaaacatcatggctagaattacgaagaaataacacgattgaccccatgataactttcctc
gaaaggatgaacatttctggattcgatgcaaaatcatatataaacagcgtctccggcaat
gcatctacattaccgaatatcggtatagcgatttctggaggaggctaccgtgcaatgttg
aatggtgctggattcatcgctgccgccgatgatcgaacggctaattcaacaaactcggga
caaatcggaggtcttttacaagctacaacctaccttgcaggtctatctggtggtggatgg
ttagtaggatcaatctacacgaacaactttagtagtgtcgaaaatttacgagatagttct
gacgtgtggaactttcaaaattcgatcttcgaagggcctaacgatgatcatattcagatc
ttgagtactgctgattactacagcaccatcaagagcgaggtttctggaaaagcagatgcc
cctctcaatttcaatacatcgatcaccgattattggggacgcgcattatcctttcaattg
gtcaatgctacagatggtggaccagcttatacattttcatcaattgcactccaggacaac
ttcgcaaatggcgaaattcctatgccttttctcgtcgctgacggccgttcgccatacacc
gagatcatatcactaaattcaaccgtctacgaattcaatccgtttgagcttggttcatgg
gatcctacgacatacgccttcgcaccccttcgttatattggttcaaatttcaccgctggt
tccatccctgacggtcaacaatgtgttcgtggttttgatcaagtcggctacgtgatgggt
acttcgtcctcacttttcaaccaatttttgattcaagccaatcaaagttcgcttccaact
attgtcaccgaagcgttcaccgccattcttgacaagatcggattcatcaacaatgatatt
gcgcaatatcagcctaaccccttttatggattcaacaatgataccaatcgtaatgcccaa
acgacccaattagatttggtagatggtggtgaggacggccagaacgtccctctttatcct
ctcatccaacctatccgtgaagtagatgtaatcttcgcaatcgattcatctgcggacacc
acatatttctggcccaacggaacatctctcgttgcaacccacgaacgttctcaaaatgca
accattgcaaacggaaccgcattcccctcgatccctggccaaaacacattcgtcaatctt
ggactcaacaaacgccccactttcttttggtgcgatcccatcatttcagacagccaacac
ccttaa

DBGET integrated database retrieval system