KEGG   Botryotinia fuckeliana: BC1G_00617Help
Entry
BC1G_00617        CDS       T01072                                 

Definition
similar to pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bfu  Botryotinia fuckeliana
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bfu00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfu00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 348 aa AA seqDB search
MRSFALLSLTASLLGSVSASPALVNRAVAFNRTVAPAGAIVVDETCEIAGSYTTFQEGID
ALSTTTTDAQYIFVAPGTYFEQVYLPPLASNLTIQGYTTDARTYENNEATLTYNLALINT
TSDDLTATFRAHNTNTKVYNLIIENTFGHINSNGQNLALSSYASNVGYYATQFWGYQDTV
LAEAGYQLYAKCLIVGAIDFIFGEKALAWFENNDIRTIANGAITASGRTSAAVDSWYVIN
NSNIANLNSSLTPYNNYLGRPWRDYARVVFQNSYLGDNIKAAGWQEWSTSTPNTDGVTFG
EYNNYGPGSVLEEGPRANFSSQFTAPVDITTVLGTSYTSEFYYDASYM
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcctttgccctcctctcccttacagcttctttgctcggaagcgtctctgccagc
cctgctttagtaaaccgcgctgttgcattcaaccgaaccgttgctcccgctggtgcaatt
gtcgttgacgagacatgtgaaattgccggctcctacaccacattccaagagggtatcgat
gcattgtccaccaccaccaccgatgctcaatacatcttcgtagctcctggtacctacttc
gagcaagtgtatctcccaccactcgcatcgaaccttaccatccaaggttataccaccgat
gcccgcacctacgaaaacaacgaagccaccctcacctacaacctcgccctcatcaacacc
acctcggatgatttaaccgccactttccgtgcccacaacaccaacaccaaagtgtacaac
ttgatcatcgagaacacattcggtcacatcaactccaatggacagaaccttgctctctcc
tcctacgcctccaacgtgggttactacgccacccaattctggggttaccaagacaccgtt
ctcgccgaggccggttaccagctctacgccaagtgcttgatcgtcggagccattgatttc
atcttcggtgagaaagctctcgcctggttcgagaacaacgatatccgtaccattgccaac
ggagctattaccgcatcgggtcgtacaagcgccgctgtcgattcctggtatgtgattaac
aactccaacattgccaatctcaacagcagtctcactccatacaacaactatctcggacga
ccatggagagattacgcacgtgttgttttccaaaacagttatttgggtgacaacatcaaa
gcggctggatggcaagagtggagtacctcgactccaaacactgatggagttactttcgga
gaatacaacaactacggacccggaagcgttctcgaagaaggcccccgtgcaaacttcagc
tctcaattcacagctcccgttgacatcaccaccgtcttgggtacatcctacactagcgag
ttctactacgatgcttcttacatgtaa

DBGET integrated database retrieval system