KEGG   Botrytis cinerea: BC1G_00654Help
Entry
BC1G_00654        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bfu  Botrytis cinerea
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BC1G_00654
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BC1G_00654
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1G_00654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 582 aa AA seqDB search
MMMHPTPPPSISHSDIDSYKYRRDAEYRNIEAPRTEDAEYIEHIEQTKAHLPEDLTQTEE
EEQRQWFIGSIDQGTTSTRFIIFNGQGQPVAMHQHEFENMYPESGWHEHDPQELVNSVDE
CVEKATEKFLELGHKKSDIKAIGITNQRETTICWDTITGEPLYNAVVWADTRTTALVREL
KDSEGADEILQLCGLPLSTYPASVKLMWMYRNVEAIKNAYDEGRLSFGTVDSWLIYKLNG
GKEGGVHVTDTTNASRTMFMNLHTLQYDDKLLNFFQLDRKNVTLPKIVPSSDKEAFGKMA
YGALEGTKITGCLGDQSSALVGQCGFKPGHAKNTYGTGCFLLYNVGDKPVVSKYGLLATV
AYDFGNGRKPVYALEGSIAVAGSGVKFLMNNLGFIAHSSKITELAETVDDNGGVVFVTAF
SGLFAPYWIDDAKGTLFGVTQHTQRGHIARATLEATCFQTKAILDAMEKDSGHKLEGLAV
DGGMSNSDLCMQTQADVLNIPINRPVMRETTALGAAIAAGFAVGIWKEFDELKEINRDDR
TIFEPKIKPAKAARMFKKWGQAVEMSRGWVLQNEDENDDDVD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcatccaacaccaccgccctcgatatcacacagtgatatcgatagttacaaa
tacagaagagacgcagaatacagaaacattgaggcgccaagaacagaagatgccgaatac
atcgagcacatcgaacaaactaaagcacatcttccagaggatttgactcaaaccgaggag
gaagaacaaagacagtggttcattggtagcattgaccaaggcacaacctccacaagattc
atcatcttcaatggacaggggcaacctgtagccatgcaccagcatgaattcgagaacatg
taccccgagtctggatggcatgagcatgatcctcaagaattggtcaactctgtcgatgag
tgcgtagagaaggcaacagaaaaattcctcgaattaggacacaagaagtccgacatcaaa
gctattggaattaccaaccaacgtgaaacaactatctgttgggacacaatcactggagaa
ccattgtacaacgccgttgtttgggctgatacccgaaccaccgctcttgtacgcgagctc
aaggattcagaaggcgcagatgagatcctccaattgtgtggtctgccactctctacatac
cctgccagcgttaagctcatgtggatgtaccgaaacgttgaagctatcaagaacgcatac
gatgaaggcagattatcttttggaacagtcgactcttggctgatctacaaactcaatgga
ggaaaggaaggtggtgttcacgtcacagataccacaaatgcttccagaactatgttcatg
aaccttcacacattacaatacgacgacaaactcctcaacttcttccaacttgacagaaaa
aacgtcacccttccaaaaatcgttccttcctcagacaaggaagcttttggtaagatggcc
tacggtgctctcgaaggcaccaaaatcactggctgtcttggagatcaatcatccgccttg
gtcggtcaatgcggcttcaagcctggccatgcaaagaacacatacggaactggttgtttc
cttctctacaacgttggtgacaagcctgtagtatccaaatatggtcttttggctactgtc
gcatacgattttggcaatggcagaaaaccagtttatgctcttgagggtagcattgctgtt
gcaggttccggtgtcaagttcttgatgaacaacttgggattcattgcacattcaagcaaa
atcactgaattggcagagactgttgatgacaacggaggtgtagtatttgttactgctttc
tctggtttattcgctccatactggattgatgatgccaagggaacactttttggtgttact
caacacacacaacgtggccacattgcccgtgctacccttgaagctacctgtttccaaacc
aaagccatccttgatgctatggagaaggattctggacacaagttggaaggacttgctgtc
gatggtggcatgtccaactctgacctttgcatgcaaacacaagccgatgttctcaacatc
ccaatcaacagacccgttatgcgcgaaaccacagctctcggagccgcaatcgcagctggt
ttcgcagttggcatctggaaggagtttgatgaactcaaggagatcaatcgtgacgataga
actatcttcgaaccaaagatcaagccagcaaaggctgctcgtatgttcaagaaatgggga
caagcagttgagatgagcaggggatgggtcctacaaaacgaggatgagaacgatgatgat
gttgactaa

DBGET integrated database retrieval system