KEGG   Botryotinia fuckeliana: BC1G_00828Help
Entry
BC1G_00828        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 834 aa AA seqDB search
MAGAAAAVVLMDGEPSRSLATSEDDADFEEDDDMVPDIINEDANAYAANIQLQNGLIGDH
SDLEDDREGPEGEEDMLTDEDADGEEDDEMLDGPDNMDHTEEEEADENRELGEGDEDDDD
AEGVGAVKIQPGLEDDDDEDAESGSDSDSSVEIEQDDESKGSSDVEEETRWQSNGEGEEE
EEEHVNPNRCIFCEQDEDDDPSEEFELYLACEMCGDNAHRQCARNSNALKSDEEAEKWYC
PGCHENSLVPGSPSADVDMLEGPEEEIVEAVGQEGDGVELLDEDASIAAKRRISRDRVPG
DLLPPRRGTIKSDSHSVFEQLIPPEDPMDGSRLLRKRKTSSVEADEGLVLRKRTRDRDVL
PDNSKPSFDEPHDEAKVDNDSNLSLTNGKRNKKRVDTPTSPRVSRSLRQKTSSSLGPPVN
IVEKIPGTLKISFRVDPMELRHILSIPPKPKKKRGGRGVSKARSTATSTALVPSSYSQPF
YPSIHEKELEELKSKPYGGILSEADADTSLTLPRAEHRRQFEDARQTAEEDWKARAAAAA
EAAAKAGLRKARKVSGPASQIEYIDFGAYQIDIWYAAPYPEEYSRNKALFICEFCLKYME
SDIVAWRHKTKCPWKHPPGDEIYRDGKIMIFEVDGRKNPLYCQNLCLLAKLFLGSKTLYY
DVEPFLFYVMTEYDELGCHFVGYFSKEKRPSSLNNVSCILVLPIHQRKGYGHLLIDFSYL
LTRVEKKTGSPEKPLSDMGLVSYRNYWRLVLCYYLQRFQPSERVPSIKAISDEMGLTPDD
VISGLDAMGTLVRDPTTGTYAMRLKPDYYKEVICHHEAKGRNDSIVRQNDHRGW
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagcggcagcagcagtggtgcttatggatggggagccttcccgtagtttagct
acttctgaagacgatgctgattttgaggaggatgacgacatggttcctgacataatcaat
gaggacgcgaatgcatatgctgctaatattcaattacaaaatgggttgattggggatcac
agcgatctagaggatgacagagagggaccggaaggagaagaggatatgttaacagatgaa
gatgcagatggagaggaggacgacgaaatgcttgacgggccagacaacatggatcatact
gaggaagaagaggcagatgaaaaccgagagctgggtgaaggagatgaggatgacgacgat
gcggagggagttggtgcagtcaaaattcagcctggcttagaggatgacgatgatgaagac
gcagagagtggctccgatagcgacagctccgtggaaattgaacaagatgacgaatctaag
ggctctagcgatgtcgaggaagaaacacgatggcaatctaatggggaaggtgaagaggaa
gaggaagaacacgtaaatccgaatcgctgcatattctgcgagcaagacgaggacgatgat
ccgagtgaagaattcgaactttatctggcatgtgagatgtgtggagacaatgcgcatcgg
caatgcgcccgaaattcaaatgcgctcaagtctgacgaagaggcggaaaaatggtattgt
ccaggatgccacgaaaacagtctcgtgcccggaagtccaagtgcagatgtcgatatgctt
gaaggcccagaggaagaaatagtggaggcagtcggtcaagagggagatggtgtagaactt
cttgatgaagatgcatcaatagcggccaagaggagaatatcgagggacagagttccaggg
gacctattaccgccaagacgtggtacaatcaaatcagattcacactccgtcttcgaacaa
ctaataccaccagaagatcccatggatggctcacgtttgttgcgtaagagaaaaacttca
tccgtggaggctgatgagggactagttttgagaaaaaggactcgtgatcgagatgtactt
cccgacaattccaaaccatcatttgacgaaccacatgatgaagccaaagtcgacaacgat
agcaacttatcattgactaacggcaaaaggaataagaagagggtagatacgcctacaagc
ccgcgtgtttcaagatccttacgtcaaaagacttcttcatctttaggtccgccagttaac
attgtcgagaaaatacctggcactctcaaaatctcctttcgtgttgatcctatggagttg
aggcatattctctcaataccccctaaaccaaaaaagaaacgcggtggtcgtggcgtctca
aaggctcgatccacagctacttctaccgctcttgtcccctcgagctactcacaacctttc
tacccctccattcacgagaaagaattggaagagctgaaatccaaaccttacggtggcatt
ctttccgaagctgacgctgatacatctttgacactacctagagcagagcatcggcgtcaa
tttgaagatgctcgtcaaacggctgaagaggattggaaagcaagggcagcggctgcggca
gaagctgctgccaaggcaggattgagaaaagcacgcaaggtgtcaggtccagccagccaa
attgaatatattgattttggggcatatcaaatcgatatttggtatgctgctccatatcca
gaagaatatagccggaataaggcacttttcatatgtgagttctgtttgaagtacatggag
tccgatattgttgcttggaggcataaaacgaaatgcccatggaagcatcctcctggcgat
gaaatataccgggatggaaagattatgattttcgaagtggatggccgcaagaacccactg
tactgccaaaatctttgtctcctagcaaagctctttctcggatcgaaaactctttactat
gatgtcgagcctttccttttttatgtcatgacagaatatgacgaactgggttgtcacttt
gtgggctatttttcgaaggagaagcgacctagcagcctcaacaacgtctcatgtattctc
gtattgcctattcatcaacgaaagggatatggtcacctgctcatcgacttttcgtatctt
ctcactcgcgttgagaagaagactggctctcctgagaagccactttcggatatgggtcta
gtctcttaccgtaattactggcgactcgttctatgttattacttacaaagatttcagccc
tctgaacgtgttccaagtatcaaggctatttctgacgaaatgggtttaacgccagatgat
gttatatctggccttgatgccatgggcactctcgtccgcgatccaacaactggtacctat
gccatgagattaaagccggattactacaaagaggttatttgccatcatgaagcaaaagga
agaaatgacagcatcgttaggcaaaatgaccaccggggctggtga

DBGET integrated database retrieval system