KEGG   Botryotinia fuckeliana: BC1G_00847Help
Entry
BC1G_00847        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bfu  Botryotinia fuckeliana
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bfu00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 176 aa AA seqDB search
MRAYWFDNEEGDQRELHDSGRDVNPEYLEKLGVLYYRFADEKDVDKLASDRSYKNRDVIT
VSPEKMGDIYEEKVKSFFNEHLHEDEEIRYIRDGAGFFDVRSEGDEWVRIRLEKDDLIIL
PAGIYHRFTTDANNYIQAMRLFKEEPKWTPLNRGPDVDVNPYRKEYLQTVPAIAGQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttactggtttgataacgaggagggcgaccaacgggaacttcacgactcgggc
cgcgacgttaaccctgagtacttggagaagctcggggttctctattacagattcgcagat
gagaaagatgtcgacaagctcgcctctgacagaagctacaagaatcgcgatgtaattacg
gtttcaccagagaaaatgggtgatatctacgaggagaaggtcaagtcgttcttcaatgag
catttgcacgaagatgaggagattagatatatcagagatggagcgggattcttcgatgtc
aggagtgagggcgatgagtgggttcgcattaggttggaaaaggacgacttgatcattctc
ccagctggtatctaccatcgttttaccactgatgcaaacaactatatccaagcaatgaga
ttgttcaaggaggaacccaaatggactcctttgaaccgtggtccggacgttgacgtcaat
ccataccgcaaggagtacttgcaaactgttcctgcaattgcaggccagtaa

DBGET integrated database retrieval system