KEGG   Botrytis cinerea: BC1G_00847Help
Entry
BC1G_00847        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bfu  Botrytis cinerea
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BC1G_00847
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BC1G_00847
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BC1G_00847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 176 aa AA seqDB search
MRAYWFDNEEGDQRELHDSGRDVNPEYLEKLGVLYYRFADEKDVDKLASDRSYKNRDVIT
VSPEKMGDIYEEKVKSFFNEHLHEDEEIRYIRDGAGFFDVRSEGDEWVRIRLEKDDLIIL
PAGIYHRFTTDANNYIQAMRLFKEEPKWTPLNRGPDVDVNPYRKEYLQTVPAIAGQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttactggtttgataacgaggagggcgaccaacgggaacttcacgactcgggc
cgcgacgttaaccctgagtacttggagaagctcggggttctctattacagattcgcagat
gagaaagatgtcgacaagctcgcctctgacagaagctacaagaatcgcgatgtaattacg
gtttcaccagagaaaatgggtgatatctacgaggagaaggtcaagtcgttcttcaatgag
catttgcacgaagatgaggagattagatatatcagagatggagcgggattcttcgatgtc
aggagtgagggcgatgagtgggttcgcattaggttggaaaaggacgacttgatcattctc
ccagctggtatctaccatcgttttaccactgatgcaaacaactatatccaagcaatgaga
ttgttcaaggaggaacccaaatggactcctttgaaccgtggtccggacgttgacgtcaat
ccataccgcaaggagtacttgcaaactgttcctgcaattgcaggccagtaa

DBGET integrated database retrieval system