KEGG   Botrytis cinerea: BC1G_01559Help
Entry
BC1G_01559        CDS       T01072                                 

Definition
similar to phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bfu  Botrytis cinerea
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BC1G_01559
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    BC1G_01559
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     BC1G_01559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1023 aa AA seqDB search
MSSLTSSPNLTPTTSRAPTQQQQQQQSPHMPPYPQRSSSLNRRRGISRVRTEFLPTITSA
PTVPMSASSVTTSSSVQASPVMSPETSQVMTNNSSLQVSPEGPRGREPEHRLPPFEPLPD
SVVSRKHSQTAMAETFTGNRSQGLMRRLSNKISRRQSTNTSREQSAGPVMLRRRSDSTST
APDSRHYLLNSDSDEDVHEDTIEWVDSPLGIEGLVGDYPSSNASFACSSTMTGGNAGLAF
GPVIPTVLLQGTTMIKITKKKRKVLTFVLEDEACKVSWDKTRPAKSFLIDNIKEIRLGSD
ALNYREEFKVDSQDEPRFFSILYVVPDNKSTGRSTKIMHLIAPDEQTFDLWTTTLEAISK
HRYENMSSLVAFNEKAVRNYWRGEMTKQFSDTPHAEDEEALDFEGVEQLCKNLHINTSSR
FLRERFQQADATKSKKLIFSEFQEFVKLMKRRGDVSEIYRELASDNVKGITLEEFIDFVN
VVQGENVEKDRAKWESIFAKFARRSRSRDQPLQEGEAARMSEEALATFFTSVHNVPLETV
PETFTLDRPMHEYFISSSHNTYLMGRQVAGESSVEAYISALIKGCRPIMFSDVMYTIAKY
AFVKSHFPLWISLEVHCNDAQQAAMAQIIKEACGDLLVTEPLDPSSQVLPSPSQLMDRIL
IKVKKPRISDESSPKVNGRSRGNSLSSPRVYPAGLDNSTISSGSLLPPPTANPSGSHIKQ
NIRRTGTDETTSSSSSDSEGNEDRPKDKPKTSKIVKVLGELGIYSAGVKFRGCMQMNDAM
FAGGTDQSGYVLKPSELREIKMLPSVPEEAGADHVKRERKNVNFSIDIISAQQLMRPKGL
PSNRSVDPYIEVEVYHADDKSKETKGVIGEGGLDASAKDGSSGLGAPHKRRTHIVQENGF
NPVFNKKFNFALTTKFPELVFVRWTVRCSSDGHSYNDKTLPLATYTAKLSSLKQGYRTLP
LYDTNGDQFLFSTLFCRVKIDPATSIYVNAESNESVGVLKSLGRTVFNRTPLSPKPSVDS
NHQ
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcttacgtcgagtcccaacctgactcccaccacctcgagagctcccacacaa
caacaacaacaacaacagtctcctcacatgcccccgtatccacagaggtcgtcctcctta
aatcgaagacgtggtatatcgcgtgtgcgaaccgaattccttcccactattacttccgct
cccaccgttccaatgtcggcttcctcggtcaccacctcgagctctgtgcaagcatcgcca
gtcatgtcacccgaaactagtcaggtcatgaccaacaactcctcattacaagtatcgccc
gaaggcccacgaggccgtgaacctgagcatcgcctcccccctttcgaacctctgcccgat
tcagtcgtctcacggaagcacagtcaaactgccatggccgagacattcacgggcaatcgg
tcgcaaggcttgatgaggaggttatcgaacaagatctcaagacgtcagtctacaaataca
agtcgggaacaaagtgctggcccagtcatgttgcgacgtcgaagcgacagcaccagtaca
gccccagattccagacactacctactcaactctgattccgacgaggacgttcacgaggat
accattgaatgggtggattcgccattgggtatcgaaggtcttgtcggggactatcccagt
tccaatgcctcgttcgcttgctcgtcgaccatgactggcggcaacgcaggcctcgcattc
ggtccggttatccctacggttctgctccaaggcaccacgatgatcaagatcacaaagaag
aagagaaaggttcttacatttgttctcgaagatgaagcttgcaaagtatcgtgggacaag
acaagacccgcgaaaagcttcctcatcgacaacatcaaggaaattcgtctcggatcggac
gcccttaactatcgcgaggaattcaaggttgactctcaggacgaacctcgtttcttctcc
atcctctacgtggtacctgacaataagtcgaccgggcgctcgacgaaaatcatgcatttg
attgccccagatgaacaaacattcgacctttggacgacgacccttgaagctatatctaaa
catagatatgaaaacatgtccagcctggttgcatttaacgagaaggctgtccgaaactac
tggcgcggcgaaatgaccaagcagttttccgacactcctcatgccgaagacgaagaggct
ctcgatttcgaaggagtcgagcagctttgcaaaaatctccacatcaacacttcgtccaga
ttcttacgcgagagatttcaacaagcagatgctaccaagtcaaagaagttgatcttctcc
gagtttcaagaattcgtgaagctcatgaagcgaagaggggatgtttccgagatctacaga
gagctcgcttctgacaatgttaaaggaattacacttgaagagtttattgacttcgtcaac
gtcgtgcaaggggaaaatgtggagaaggatcgagcgaaatgggaatctatttttgccaaa
tttgcccgtcgatcaagatcacgagatcagccattgcaagaaggtgaggctgcacgaatg
agtgaagaagctctagccacatttttcacatccgtccataatgttcccctcgagactgtt
cccgagaccttcactctcgatcgtcccatgcacgaatacttcatctccagctctcacaat
acctatctcatggggcgacaagtcgctggggaatcgagtgttgaggcctacatatctgct
ttgatcaaaggttgccgacccatcatgttctctgacgtgatgtacactattgcgaaatat
gcatttgtcaaatcacactttccattgtggatttctctcgaggttcactgcaacgatgct
cagcaggcagccatggctcagattatcaaagaagcttgtggcgatttactcgtcacagag
cctcttgatccatcttcccaggtgcttccttcgccctctcaattgatggatcgaatcttg
atcaaagtcaagaaacccagaatctccgatgaatcctctcccaaggtcaatggccggtct
cgtggcaacagtctcagctcacctcgcgtctatcccgcaggactcgataactcaaccatt
tccagtggctctctcctacctccacccactgcaaacccgagtggaagccatatcaagcaa
aacattcgaaggactggaactgatgagactacgagtagcagcagtagcgacagtgaagga
aacgaagacaggcctaaggataagcccaagacgagcaagattgtcaaagttcttggggag
cttggcatttacagtgctggtgttaaattccgtggctgtatgcaaatgaatgatgctatg
tttgcaggaggaaccgatcaatccggttatgttctcaagccaagcgagcttcgagagatc
aaaatgcttcctagtgttccagaggaagcgggagcggatcacgtcaagagagaacgcaaa
aatgtgaacttctccattgacattatctctgctcaacaactcatgcgcccaaagggtctt
ccttctaatcgttctgtcgatccatatattgaagtcgaagtttatcatgcggatgataag
agcaaggagactaaaggtgtcattggcgaaggtggtcttgacgcttctgctaaggatggc
tcttctggtttaggagcccctcataaacgtcgcacacacatcgtccaggaaaatggcttc
aatcccgtcttcaataagaaattcaatttcgctttgacaaccaagtttccagaactcgtt
ttcgttcgctggactgttcgatgctcatcggatggccacagttacaacgataaaacgtta
ccactggctacatacactgccaaactcagcagtctcaaacaaggttaccgcactttacct
ctttacgacacaaacggtgatcaattcctcttctcgacactcttctgtcgtgtcaagatt
gatccagctacgagcatttatgtcaatgctgaatcaaatgaaagcgttggagtacttaag
agtctcggtcgtaccgtcttcaaccgaacccctctttcaccaaaaccttccgtcgacagc
aatcatcaatga

DBGET integrated database retrieval system