KEGG   Botryotinia fuckeliana: BC1G_01559Help
Entry
BC1G_01559        CDS       T01072                                 

Definition
similar to phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bfu  Botryotinia fuckeliana
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bfu00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bfu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1023 aa AA seqDB search
MSSLTSSPNLTPTTSRAPTQQQQQQQSPHMPPYPQRSSSLNRRRGISRVRTEFLPTITSA
PTVPMSASSVTTSSSVQASPVMSPETSQVMTNNSSLQVSPEGPRGREPEHRLPPFEPLPD
SVVSRKHSQTAMAETFTGNRSQGLMRRLSNKISRRQSTNTSREQSAGPVMLRRRSDSTST
APDSRHYLLNSDSDEDVHEDTIEWVDSPLGIEGLVGDYPSSNASFACSSTMTGGNAGLAF
GPVIPTVLLQGTTMIKITKKKRKVLTFVLEDEACKVSWDKTRPAKSFLIDNIKEIRLGSD
ALNYREEFKVDSQDEPRFFSILYVVPDNKSTGRSTKIMHLIAPDEQTFDLWTTTLEAISK
HRYENMSSLVAFNEKAVRNYWRGEMTKQFSDTPHAEDEEALDFEGVEQLCKNLHINTSSR
FLRERFQQADATKSKKLIFSEFQEFVKLMKRRGDVSEIYRELASDNVKGITLEEFIDFVN
VVQGENVEKDRAKWESIFAKFARRSRSRDQPLQEGEAARMSEEALATFFTSVHNVPLETV
PETFTLDRPMHEYFISSSHNTYLMGRQVAGESSVEAYISALIKGCRPIMFSDVMYTIAKY
AFVKSHFPLWISLEVHCNDAQQAAMAQIIKEACGDLLVTEPLDPSSQVLPSPSQLMDRIL
IKVKKPRISDESSPKVNGRSRGNSLSSPRVYPAGLDNSTISSGSLLPPPTANPSGSHIKQ
NIRRTGTDETTSSSSSDSEGNEDRPKDKPKTSKIVKVLGELGIYSAGVKFRGCMQMNDAM
FAGGTDQSGYVLKPSELREIKMLPSVPEEAGADHVKRERKNVNFSIDIISAQQLMRPKGL
PSNRSVDPYIEVEVYHADDKSKETKGVIGEGGLDASAKDGSSGLGAPHKRRTHIVQENGF
NPVFNKKFNFALTTKFPELVFVRWTVRCSSDGHSYNDKTLPLATYTAKLSSLKQGYRTLP
LYDTNGDQFLFSTLFCRVKIDPATSIYVNAESNESVGVLKSLGRTVFNRTPLSPKPSVDS
NHQ
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcttacgtcgagtcccaacctgactcccaccacctcgagagctcccacacaa
caacaacaacaacaacagtctcctcacatgcccccgtatccacagaggtcgtcctcctta
aatcgaagacgtggtatatcgcgtgtgcgaaccgaattccttcccactattacttccgct
cccaccgttccaatgtcggcttcctcggtcaccacctcgagctctgtgcaagcatcgcca
gtcatgtcacccgaaactagtcaggtcatgaccaacaactcctcattacaagtatcgccc
gaaggcccacgaggccgtgaacctgagcatcgcctcccccctttcgaacctctgcccgat
tcagtcgtctcacggaagcacagtcaaactgccatggccgagacattcacgggcaatcgg
tcgcaaggcttgatgaggaggttatcgaacaagatctcaagacgtcagtctacaaataca
agtcgggaacaaagtgctggcccagtcatgttgcgacgtcgaagcgacagcaccagtaca
gccccagattccagacactacctactcaactctgattccgacgaggacgttcacgaggat
accattgaatgggtggattcgccattgggtatcgaaggtcttgtcggggactatcccagt
tccaatgcctcgttcgcttgctcgtcgaccatgactggcggcaacgcaggcctcgcattc
ggtccggttatccctacggttctgctccaaggcaccacgatgatcaagatcacaaagaag
aagagaaaggttcttacatttgttctcgaagatgaagcttgcaaagtatcgtgggacaag
acaagacccgcgaaaagcttcctcatcgacaacatcaaggaaattcgtctcggatcggac
gcccttaactatcgcgaggaattcaaggttgactctcaggacgaacctcgtttcttctcc
atcctctacgtggtacctgacaataagtcgaccgggcgctcgacgaaaatcatgcatttg
attgccccagatgaacaaacattcgacctttggacgacgacccttgaagctatatctaaa
catagatatgaaaacatgtccagcctggttgcatttaacgagaaggctgtccgaaactac
tggcgcggcgaaatgaccaagcagttttccgacactcctcatgccgaagacgaagaggct
ctcgatttcgaaggagtcgagcagctttgcaaaaatctccacatcaacacttcgtccaga
ttcttacgcgagagatttcaacaagcagatgctaccaagtcaaagaagttgatcttctcc
gagtttcaagaattcgtgaagctcatgaagcgaagaggggatgtttccgagatctacaga
gagctcgcttctgacaatgttaaaggaattacacttgaagagtttattgacttcgtcaac
gtcgtgcaaggggaaaatgtggagaaggatcgagcgaaatgggaatctatttttgccaaa
tttgcccgtcgatcaagatcacgagatcagccattgcaagaaggtgaggctgcacgaatg
agtgaagaagctctagccacatttttcacatccgtccataatgttcccctcgagactgtt
cccgagaccttcactctcgatcgtcccatgcacgaatacttcatctccagctctcacaat
acctatctcatggggcgacaagtcgctggggaatcgagtgttgaggcctacatatctgct
ttgatcaaaggttgccgacccatcatgttctctgacgtgatgtacactattgcgaaatat
gcatttgtcaaatcacactttccattgtggatttctctcgaggttcactgcaacgatgct
cagcaggcagccatggctcagattatcaaagaagcttgtggcgatttactcgtcacagag
cctcttgatccatcttcccaggtgcttccttcgccctctcaattgatggatcgaatcttg
atcaaagtcaagaaacccagaatctccgatgaatcctctcccaaggtcaatggccggtct
cgtggcaacagtctcagctcacctcgcgtctatcccgcaggactcgataactcaaccatt
tccagtggctctctcctacctccacccactgcaaacccgagtggaagccatatcaagcaa
aacattcgaaggactggaactgatgagactacgagtagcagcagtagcgacagtgaagga
aacgaagacaggcctaaggataagcccaagacgagcaagattgtcaaagttcttggggag
cttggcatttacagtgctggtgttaaattccgtggctgtatgcaaatgaatgatgctatg
tttgcaggaggaaccgatcaatccggttatgttctcaagccaagcgagcttcgagagatc
aaaatgcttcctagtgttccagaggaagcgggagcggatcacgtcaagagagaacgcaaa
aatgtgaacttctccattgacattatctctgctcaacaactcatgcgcccaaagggtctt
ccttctaatcgttctgtcgatccatatattgaagtcgaagtttatcatgcggatgataag
agcaaggagactaaaggtgtcattggcgaaggtggtcttgacgcttctgctaaggatggc
tcttctggtttaggagcccctcataaacgtcgcacacacatcgtccaggaaaatggcttc
aatcccgtcttcaataagaaattcaatttcgctttgacaaccaagtttccagaactcgtt
ttcgttcgctggactgttcgatgctcatcggatggccacagttacaacgataaaacgtta
ccactggctacatacactgccaaactcagcagtctcaaacaaggttaccgcactttacct
ctttacgacacaaacggtgatcaattcctcttctcgacactcttctgtcgtgtcaagatt
gatccagctacgagcatttatgtcaatgctgaatcaaatgaaagcgttggagtacttaag
agtctcggtcgtaccgtcttcaaccgaacccctctttcaccaaaaccttccgtcgacagc
aatcatcaatga

DBGET integrated database retrieval system