KEGG   Botryotinia fuckeliana: BC1G_01778Help
Entry
BC1G_01778        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 487 aa AA seqDB search
MHISNLITLAILPLAYGQLDTLAKAAGLKYFGSATDNGELTDTQYTAILSNNSQFGQITP
GNTQKWQYIEPTQNTFSYTKGDVVVDFAEKNDQILRCHNLCWYNQLPSWVTSGTWTNETL
IAVLKNHIKNEVTYYKGKCYAWDVVNEAFNDDGTWRSFVFYDTIGPEYIPIAFETAALYD
PDVKLYYNDYNIESSGAKATATLNLVKSLQARGIKIDGVGLQAHFIVGSTPSESALATTL
KSFTALNVEVAYTELDVRFSSLPPTTAGLAQQGVDYANTVNACLSVDGCVGITIWDFTDA
YSWIPSTFSGQGDACLWYANYTVHPAYNNVVAALAAAAGTVAPVTSTIVSATSTAKVSES
SAVSTSPSAPAVLISSSVSVSAVVPSVSSVVQVASSSVLSSAAVSSAVSVPISSSPIPSS
STLKKCTKTLSSTTITKTTSTAAASGTGAAVALYGQCGGVNYKGSTVCAAGATCTAQNDY
YSQCIPA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcatatatcaaatcttataactcttgctatcttgcctttagcttacggtcagcttgat
acgcttgccaaggctgctggcctcaaatactttggttccgccacagacaacggcgaactt
actgacacccaatacaccgctatcttgtcaaacaacagtcagttcggacaaatcacacct
ggaaatacacaaaaatggcaatacatagaacccacccaaaacacattcagctataccaag
ggagatgttgttgttgatttcgcagagaagaatgatcaaattctgagatgtcataacttg
tgttggtataatcaattgccgtcatgggttacttcgggcacatggacgaatgagacttta
attgcggtcttgaagaaccacattaaaaatgaggtaacttactacaagggcaaatgctac
gcctgggatgtcgtcaatgaggcattcaacgatgatggtacctggagatcatttgtcttc
tatgacaccattggtcctgaatatatcccaatcgcattcgaaaccgcagctctctacgac
ccagatgtcaagctctactacaacgattacaacatcgagtcttccggtgcaaaggcaacc
gctaccctcaacctcgttaagtctctccaagcccgcggtatcaaaatcgacggtgtcggt
ctccaagcccacttcatcgtcggctccacccccagcgaatccgccctcgctaccaccctc
aaatccttcaccgctctcaatgtcgaagtcgcctacaccgaactcgacgtccgcttcagc
tctctcccccccaccaccgccgggctcgcccaacaaggtgtcgactacgctaacaccgtc
aacgcctgtctcagcgtcgacggctgcgtcggtatcaccatctgggacttcacagatgcg
tattcgtggatcccatcgaccttctctggccaaggtgatgcctgtctctggtacgctaac
tataccgttcaccccgcctacaacaacgtagttgctgctctcgccgccgcagcaggcaca
gtcgcccccgttacttctactattgtttctgctacatccacagcgaaagtaagtgaatcc
agtgcggtttctactagtccatctgcgccggccgttttgatctctagttctgtttccgtt
tctgcagttgtaccttctgtctcttcagttgtgcaagttgccagttcttctgtcctctct
tctgcggctgtttcctctgctgtctctgttcctatttcctcatctcctatcccctcaagc
agtacactaaaaaaatgcacaaagaccctctcttccaccaccatcacaaaaaccacctct
acagccgcagcttcgggaactggcgccgcagtcgctctttacggacaatgtggcggcgtg
aactacaagggaagtaccgtgtgtgcggccggcgcgacctgcaccgcgcagaatgattat
tactcgcagtgcattccggcatag

DBGET integrated database retrieval system