KEGG   Botrytis cinerea: BC1G_02223Help
Entry
BC1G_02223        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bfu  Botrytis cinerea
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BC1G_02223
Enzymes [BR:bfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BC1G_02223
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BC1G_02223
  Exosomal proteins of colorectal cancer cells
   BC1G_02223
  Exosomal proteins of bladder cancer cells
   BC1G_02223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 531 aa AA seqDB search
MRYLQCVALAFASAAIASASDVASLTKETFPDFIKENDLALLEFFAPWCGHCKALAPEYE
EAATTLKEKKIALAKVDCTEEADLCQSFGVEGYPTLKVFRGAENVSPYSGARKAPAIVSY
MTKQSLPAVSVLTKDTLEDFKTADKVVLVAYFDAEDKTSNTTFNTVAEKLRDDYLFGASN
DAALAKAEGVSFPSIVLYKSFDEGKAIYPDAFDAEVIEKFAKTASIPLIGEVGPETYAGY
MATGIPLAYIFAETPEERTTLAETLKPVAEKHRGAISFATIDAKAFGAHAGNLNLDADKF
PAFAIQSTVDNKKYPFDQSVEITEASISKFVQQYVDGKVEPSIKSEPIPEKQEGPVQIVV
AHNYDDIVLDDKKDVLIEFYAPWCGHCKALAPKYDILAGLYADAGYTDKVTIAKVDATLN
DVPDEIQGFPTIKLYKAGNKKNPVTYNGSRSIEDLIKFIKENGQHEIEVAYDENAAASPE
AEKPIAESLAKQAEAATESAKSAAEEASETVSSKVAEATETAAATEDHDEL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctacaatgtgttgcattggcttttgcatcagctgcaattgcttcggcctct
gatgtcgcttccctcaccaaggaaacattcccagatttcatcaaggagaatgatttggcc
cttctagagtttttcgcaccttggtgtggtcactgcaaagcattggcccctgagtatgaa
gaagctgctacaacattgaaggagaagaagattgccttggccaaggttgattgcacagaa
gaagccgatctctgccaaagctttggcgttgagggttacccaactctcaaggtcttccgt
ggcgcagagaatgtttccccatattccggcgcaagaaaagccccagcgattgtctcatac
atgaccaagcaatccctccccgccgtctcagtcttaaccaaggatacattggaggatttc
aagactgccgacaaggtagttttggttgcatacttcgatgctgaggacaagacctcaaac
accaccttcaacacagttgcggagaaactccgtgacgactacctcttcggtgccagcaat
gatgcagctttggcaaaagctgagggtgttagcttcccatctattgtcctttacaagtca
ttcgatgagggcaaagctatctacccagatgctttcgacgccgaggttattgagaagttc
gcaaagactgcgtccatcccattgattggcgaagttggcccagaaacatacgctggatac
atggccactggaattccattggcatacattttcgccgaaaccccagaggagagaactact
ctcgctgagactcttaagccagtcgcagagaagcaccgtggtgccatcagctttgcaacc
attgacgcaaaggctttcggagctcacgctggtaacttgaaccttgacgccgacaagttc
cctgctttcgctatccaaagcactgtcgacaacaagaaatatcctttcgatcaaagtgtt
gagatcactgaagcttccattagcaagttcgtccaacaatacgttgacggaaaggttgag
ccaagcatcaagtctgagccaatcccagagaagcaagaaggcccagttcaaatcgtcgtt
gctcacaactacgatgacatcgttttagatgacaagaaggatgttttgattgagttctac
gctccatggtgtggacactgcaaggctcttgcaccaaaatacgatatcctcgctggcctt
tacgctgatgctggttacactgacaaggttaccatcgctaaggtcgatgctactctcaac
gatgtcccagatgagattcagggtttcccaaccatcaagttgtacaaggctggtaacaag
aagaacccagttacctacaacggtagccgtagcatcgaagatttgattaagttcattaag
gagaacggccaacatgagattgaagttgcatatgatgagaacgccgctgcttccccagag
gcagagaagccaattgctgagtctttggccaagcaagcagaagccgccaccgagtctgct
aagagcgctgctgaggaggctagtgagactgtttctagcaaggtcgctgaggccaccgag
accgcagctgctactgaggatcatgacgagttgtga

DBGET integrated database retrieval system