KEGG   Botrytis cinerea: BC1G_02741Help
Entry
BC1G_02741        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
bfu  Botrytis cinerea
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BC1G_02741
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     BC1G_02741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 522 aa AA seqDB search
MATSPTSSNPFSPPGQTASSGSAGQFDIDNTLFVSKDVSLSLSPESLVIKGAETANKPEK
GAKSAGARRSVTLDASAYSEPVGSSNLRAIPLRQILWAEITETELIINYAKEISKIVLQP
AVLKYVIEEERDRVEAWVSRLKDRAYGKSQQQKRVKVIINPKSGKGQSEKIYAKDVAPIL
DAAHLSIDVTVTKASREATDIVEKLDIEAYDVIICCSGDGLPFEVFNGLGKRKDAMKALS
KMAIAHIPCGSGNGLHCSLHGNIRSTSIAALSIVKGIRTPLDLISVTQGEERHLSFLSQA
LGIVAEFDLGTEHLRWMGGTRFVYGFVMKSLQKKIFPCDIAVKVVTDDKEDIKRRYRDAM
EVGSTSEELLRENSSLEGGLPELKYGNSSDPLPEGWEVEQHDNLGSFYCGNMSWMGADVD
YFPAALPNDGCMDMVTIDYSKLSRLQALQLLPAVESGKFFGLPYVNYRKVEAYRITPKNQ
SDGYISIDGERVPFGPFQAEVHRGLGTVLSVSGYRYETLGPK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatctcctacatcctctaatcctttttctccaccaggacaaactgcttcaagt
ggcagcgctggtcaattcgatattgataacacactgtttgttagcaaagatgtctctttg
tccttgagtcctgagtccttagttatcaaaggcgccgagacagcaaacaagccggagaaa
ggagcaaaatcagccggtgcccgtcgttccgtaacattggatgcatctgcctattcagaa
cctgttgggtcgtcaaatttaagggcaatccctttacgtcagatcctttgggctgaaata
actgagactgaactcatcataaattacgcaaaggagatttcaaagattgttcttcaacca
gcggtactgaagtatgttatcgaagaagagcgagaccgagtggaagcgtgggtttctagg
ctcaaagatcgcgcatatggaaaatcccagcagcagaaacgagttaaagtgataattaac
ccaaagagtggaaagggacaatccgagaaaatctatgcaaaagacgttgcgcctattctt
gatgctgctcatctttctatcgatgtgacagtaactaaagcctcaagggaggccactgat
atcgtggaaaaactcgacatagaagcttatgatgtgataatttgttgttctggagatggt
cttccatttgaggttttcaatggtcttggcaaacgtaaagatgcaatgaaagctctttcg
aaaatggccatagcgcacataccttgtggatctggaaatgggctacattgcagtcttcat
ggcaatatcagatctaccagtattgcagccctttcaatagttaaaggtattcgtactcct
ttagacttgatttcggtcacacaaggcgaagagagacatttatcctttctctcgcaagca
ctcggtattgtggccgaatttgacctgggaacagagcatttgcggtggatgggaggaaca
cgattcgtttatgggtttgtcatgaagtctctccaaaagaaaatcttcccatgtgacatt
gcagtcaaggtggttacagacgacaaagaagatatcaagcggcgttatcgtgatgctatg
gaagttggtagtacttctgaagaattattacgagagaatagttctttggaaggtggttta
cccgagttgaaatatggaaattctagcgacccattacctgaagggtgggaagtcgaacaa
catgacaatttgggaagcttttactgtggtaatatgtcttggatgggagcagatgtagat
tattttccagctgcacttccaaatgatggttgtatggatatggtaaccattgattattca
aaacttagtcgactccaagcactacaacttcttccggctgttgagagtggaaaattcttc
ggtctaccatatgtcaattatcgcaaagtcgaagcataccgcatcactccaaagaaccag
tcagacggttatatatcaatagacggagagcgagtgccgtttggaccattccaagccgaa
gtacatcgaggattaggaacggtactttcagtgtcaggatatagatatgagacccttggt
cctaagtaa

DBGET integrated database retrieval system