KEGG   Botrytis cinerea: BC1G_02849Help
Entry
BC1G_02849        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BC1G_02849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 502 aa AA seqDB search
MAGIDSDWSSDSNEAIYISLVTPGAEGITSLHTFNPKFTYPIFGDEESIFGYQGLRINLK
YNACDMRPGLQITYNKKFKAVGDIEPTDLKATLEPFLPKTAFEKSSVFESHISATPADWH
PPGELFRAIEVGGEIFEIWKGNLSDPVIQQTIKRVQTLVPLFIEGGTLLDLDESEDDLGR
WTVFFLYHKKPAAASFFEKSSSYVFMGFCTVYRYFVYTPATPPQSPNGDKIAPEFTIPVD
GVSFNTLPCRSRISQFLILPPFQSGGKGSLFYNAVFDYLSSDPYTREITVEDPNEAFDDL
RDINDLGRLLKDERFLKLKLDSKVKINPKGPAPAKLFDTDAYEKLRIQSKIAPRQFARLH
EMYLLSIIPPSAKAALFRDTGKPQKSLPPPRKEDEHMYYLWQLLVKQRLYRHNKDALAQF
DRGERIDKLNEALMGVEADYGRLIEIVEERIERENPTVVGKGKGKSVANGNGKRAVSEED
DEDEDDEDENEEPLAKRLKFAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggctggaatcgattccgattggtcgtccgattcaaatgaggccatttacatctccctt
gtcactccgggcgcagaaggcataacctcacttcatactttcaatccaaaattcacatat
cccatattcggggacgaggaatcaatatttggataccagggattgagaatcaacttaaaa
tacaatgcctgtgatatgcgacctggcctacaaatcacctacaacaagaagtttaaagca
gtcggtgacatagaaccaacagacctgaaggcaacgctggaaccattcttaccaaagact
gcttttgagaaatcaagtgtttttgaatcgcatatttcagctaccccagcagattggcat
ccaccaggagaactctttcgcgcaattgaggtcggtggagagatatttgaaatatggaaa
ggcaatctctcggatccggtaattcaacaaaccatcaagcgagtgcaaactctagtccca
ttgtttattgaaggaggaacattgcttgatctggatgagtcggaagatgaccttgggcgt
tggacagtattcttcttgtaccacaagaagccagccgcagcctcatttttcgagaaatct
tcatcttacgtgttcatgggcttttgtactgtttatcgctattttgtttatacgcctgct
acccctccacaatcccccaatggcgacaaaatagctcccgagtttacaatccctgttgat
ggtgtatcgtttaacacgcttccatgtcgttcaaggatatcgcaatttctcattttaccc
cctttccagagcgggggcaaaggatcactattctacaacgccgtattcgactacttatcc
agcgacccatatacaagagaaatcacagtggaggacccgaatgaagcatttgacgattta
agagatatcaacgatctgggtcgtttactcaaagacgagcgtttccttaaattaaaattg
gactctaaggtgaaaattaaccctaaaggtccagcaccagccaaactctttgataccgat
gcatacgagaagctacgaattcaatctaaaatcgcccctcgacaattcgctcgccttcat
gaaatgtatctcctgtctataatccccccatccgccaaagcagcccttttccgcgacact
ggaaaacctcaaaagtctctcccgccccccagaaaagaagatgaacatatgtattatctc
tggcaactccttgtgaagcaacgtctctatcgtcataacaaagatgcattggcgcaattt
gatcgtggagaaagaatcgataaattgaacgaggctttaatgggtgtagaggctgattat
ggaaggctaattgagatagtggaggagagaattgagagggagaatccgactgttgttgga
aagggtaaggggaagagtgtggctaatggaaatggaaagagggctgttagtgaagaggac
gatgaggatgaagatgatgaagatgaaaatgaggagcctttggctaagaggttgaagttt
gcttcttga

DBGET integrated database retrieval system