KEGG   Botryotinia fuckeliana: BC1G_02981Help
Entry
BC1G_02981        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
bfu  Botryotinia fuckeliana
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:bfu00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 702 aa AA seqDB search
MASDKTAVASGADHTQTTRRRNVPSSNGSLVNTVEVDDKKTQVKKGKQSLVGFLDEWEFL
IAPLVFTIFAFFTRLYKIGLSPIVTWDEAHFGKFGSHYIKREFYFDVHPPLGKMLVGLSG
YLAGYNGTFEFKSGEQYPEDVNYTFMRAFNAFFGAVTIPLAYYTARELNFKRPAVWFVTL
MVLCENSYTTISRFILLDSMLLCFTFTTVLCWAKFHNLQKQSWTAEWFVWLLLTGVELAS
HVAIRVICLIVIPIGVYIASFAAHFAILQNSGPGDAQMSSLFQANLRGTEVGKDSPLEIA
YGSRATIKNMGYGGGLLHSHIQTYPEGSNQQQITCYHHKDANNEWWFYPNRSQPEFDPEA
PLRYVADGDVLRFVHSQTGRNLHSHDVSAPITKADKEVSCYGNTTVGDDKDHWTMEVVKD
VSSNDRSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPKDVYTHWN
VEAHWNEKLPAADAGAYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASYFWQWPILN
VGLRMCGWDDNIVKYFLLGNPLVYWGSTASLGLLGLLVLWYLVRWQRGYDELKQSEIDQI
HYAGLYPVLGWFLHYVPFVAMARVTYVHHYYPALYFAILVFGFCADWMLRNQVKTLQYAI
YGVLYALTIALYIFFMPISWGMEGPNREYSRLKWFDSWRVTD
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgataagacagctgttgcttctggtgcggatcatactcaaacaacccgtcga
cgtaatgtaccatcatccaatggaagtcttgtaaacaccgtggaggtagatgacaagaag
acgcaagtcaagaagggaaagcaatccctagtaggatttcttgacgagtgggagttcttg
atcgcaccattggtttttacaatattcgcattctttactagattatacaaaatcggcctt
tcacctattgttacttgggatgaagctcattttggaaaatttgggtcacattacatcaaa
agagaattttacttcgatgtccatccccctcttggaaaaatgctggttggtctttccggt
tatcttgcaggttacaatggtactttcgaattcaaatctggggaacaatatcctgaggat
gtgaattacactttcatgcgtgccttcaacgccttcttcggtgccgttactattccatta
gcttactacactgctcgcgaattgaacttcaagagaccggctgtgtggttcgttacatta
atggttttgtgcgaaaactcctacaccacaatcagtcgctttattctcttggattctatg
ctcctatgcttcacattcaccactgttctttgctgggccaaattccataatctacaaaag
caaagctggactgctgaatggttcgtttggctcttgttgactggtgtcgagctcgcctca
catgtcgctatcagagtaatttgtttgatcgttatccccataggagtttacattgcctcc
ttcgctgcccacttcgccattcttcaaaacagtgggcccggtgatgctcaaatgagttca
ttgttccaagccaatttgagaggaactgaagttggaaaagatagcccacttgaaatcgca
tatggttctcgggctacgattaagaatatgggatacggcggtggtcttcttcactcccac
attcagacctaccctgaaggatccaaccaacaacaaattacttgctaccatcacaaagac
gctaacaacgagtggtggttttatcctaatcgttctcaaccagaattcgacccagaggca
ccactcagatatgttgctgatggcgatgttctacgtttcgttcattcacagactggtcgc
aacctccactcacacgatgtatcagcgcctattaccaaagctgacaaggaagtttcatgt
tatggaaacaccactgttggtgatgacaaagatcactggaccatggaagttgtcaaggat
gtttcctcaaatgatcgaagcaaaattagaaccttaaccactgctttccgactcaagcac
acaagtttaggatgttacttacgcgctggtaacgttaacttgccacaatggggtttcaag
caaatcgaagtcacttgcaccaaggacaacaatcccaaggatgtttacactcactggaac
gtggaagcccactggaacgagaaattgcctgctgctgatgctggagcttacaagtctcct
ttcattcacgactttatccatttgaatgttgctatgatgacttcgaacaacgcacttgtg
ccagaccccgacaagcaggatgatctcgcttcctacttctggcaatggccaattctcaac
gtaggattgagaatgtgtggatgggatgataatatagtcaaatacttccttcttggtaac
cctcttgtatactggggctctaccgcctctctgggtctcctcggcctactcgtgctttgg
tatctcgttagatggcagcgcgggtatgacgagcttaaacagtccgagattgatcaaatc
cactatgctggactgtacccagttcttggatggttcctccactatgtgccatttgtcgcc
atggcccgtgtcacttacgttcatcactactatccagcactctatttcgctatcttagta
tttggtttctgtgcggattggatgttaagaaaccaagttaaaactttgcaatatgctatc
tatggtgttttgtacgccttgacgattgcactttacattttctttatgcctatttcatgg
ggtatggaaggacctaatagggaatactctaggttgaagtggtttgatagctggagggtt
acagattag

DBGET integrated database retrieval system