KEGG   Botrytis cinerea: BC1G_03045Help
Entry
BC1G_03045        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bfu  Botrytis cinerea
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BC1G_03045
  Lipid metabolism
   00062 Fatty acid elongation
    BC1G_03045
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     BC1G_03045
Lipid biosynthesis proteins [BR:bfu01004]
 Fatty acid synthase
  Component type
   BC1G_03045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 135 aa AA seqDB search
MAPITKIISLLSSASLINAIVMPESVLEFPVAHDEHASVYDKNSPLPSIFNLTLSGKTRQ
NTKSSNDEDDTPLPLIIWHGLGDNYKADGLAQVGKLAEAIHPGTFVYNIHVDEDASADRT
ATFFVNVTLQIEKVC
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccattaccaaaattatctcgttgctcagcagcgcatcgctcatcaacgctatc
gttatgcctgagagtgttcttgaatttcccgtcgcgcatgatgaacatgcctctgtctac
gataaaaacagtcctcttccaagtattttcaacctcaccttgtccggaaagactcgccaa
aacacaaaatcatccaacgatgaagatgatactccacttcccttgattatctggcatgga
ctcggcgataattacaaagcggatggtcttgcgcaagttggaaaactagctgaagctatt
catcctgggacttttgtctacaatattcatgtagatgaggatgcatctgcagataggaca
gctaccttctttgtaaatgtcactcttcaaatcgaaaaggtctgctaa

DBGET integrated database retrieval system