KEGG   Botryotinia fuckeliana: BC1G_03045Help
Entry
BC1G_03045        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
bfu  Botryotinia fuckeliana
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bfu01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:bfu00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 135 aa AA seqDB search
MAPITKIISLLSSASLINAIVMPESVLEFPVAHDEHASVYDKNSPLPSIFNLTLSGKTRQ
NTKSSNDEDDTPLPLIIWHGLGDNYKADGLAQVGKLAEAIHPGTFVYNIHVDEDASADRT
ATFFVNVTLQIEKVC
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccattaccaaaattatctcgttgctcagcagcgcatcgctcatcaacgctatc
gttatgcctgagagtgttcttgaatttcccgtcgcgcatgatgaacatgcctctgtctac
gataaaaacagtcctcttccaagtattttcaacctcaccttgtccggaaagactcgccaa
aacacaaaatcatccaacgatgaagatgatactccacttcccttgattatctggcatgga
ctcggcgataattacaaagcggatggtcttgcgcaagttggaaaactagctgaagctatt
catcctgggacttttgtctacaatattcatgtagatgaggatgcatctgcagataggaca
gctaccttctttgtaaatgtcactcttcaaatcgaaaaggtctgctaa

DBGET integrated database retrieval system