KEGG   Botrytis cinerea: BC1G_03058Help
Entry
BC1G_03058        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
bfu  Botrytis cinerea
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1G_03058
Enzymes [BR:bfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     BC1G_03058
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BC1G_03058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 346 aa AA seqDB search
MAPFDKTKSYASQEETFFDDGREEELVEFVRNHHDRSKIQGSPANVLQAIDEYGRTKRYL
MNVGEDKGAIVTKIISERKPHIMVELGGYCGYSTILFGSAVRASGGAKYYSLERSPKFAK
VITALVEFAGLEEFVEVIVGPSNEGIQKLHSRGLKTIDMMFLDHYKPAYTTDLKLCEQLG
LIKKGTVLAADNVISPGNPPYLEYVRSSVEDKLQKLELEGKLDTDGFAKRSATQYGGVEA
LATGIKGNPKLIYDSQLINSFEPTGEPDGVEITRCVGEVGGMLALSSNWGVREHVITEKR
LPVHAWKYTPLYCLTPHFASSNKYSIFDSTSTNICLKPPTWRSGTA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctccatttgacaagacgaagtcatatgcttcgcaggaagaaacatttttcgatgac
ggtagagaagaagaacttgtcgagtttgtgcgaaatcatcacgatcgatctaagattcaa
ggttcgccagcaaacgtcctccaagctatcgatgagtatggacgaacgaagaggtatctt
atgaatgtaggagaggataaaggagctattgtcaccaagataatcagtgaaagaaagcct
catataatggttgagctcggagggtattgtggatattccacaatactttttggttctgca
gtacgggcttccgggggagcgaagtattattcattggagagaagtccaaagttcgcaaaa
gttatcactgctctcgtggaatttgctggtctcgaagaatttgttgaagtgatcgttggt
ccaagtaacgagggaattcaaaaactacattctcgtggattgaagaccattgatatgatg
ttcctagatcactataagccagcatacacgactgacttgaagttatgtgaacagttgggc
ctgatcaaaaaaggaacagttcttgctgccgacaatgttattagtccaggaaaccctcca
tacctagaatatgtgcgaagcagtgttgaggacaaactccagaagctggagctggagggg
aagctggatactgatgggtttgcgaaacgatctgccactcaatatggtggggttgaggct
ctagccactgggataaaaggcaatcccaaactcatatacgacagccaattgatcaacagc
ttcgagcctaccggagagccagatggagtagaaataactcgatgtgtgggagaagttggg
ggtatgttggccttgagttctaattggggagtcagagagcacgtgatcacagaaaaaaga
ctgcccgttcatgcgtggaaatacacaccgctctactgtcttacaccccactttgcaagc
tcaaacaagtactcaattttcgacagcacctccaccaacatctgcttaaaaccgcccact
tggcgcagtggtaccgcgtag

DBGET integrated database retrieval system