KEGG   Botrytis cinerea: BC1G_03086Help
Entry
BC1G_03086        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     BC1G_03086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 582 aa AA seqDB search
MRQSMRTGAVAALAASTAKAASLADVCTVANVQAALPANGTLNGINPISSSVTANTVYNA
TVSSVAYDYCNVTITYAHPGKDQVVVWYNFPSPDVYKNRFYVGGGGGYALSADPTTGLPY
GAVGGVSDAGYDAIGGTTVDEVILTGNGSVNWDSIYMFAYQALGEMTQLGKAITPLFYGS
NSSAKLYTYYEGCSDGGREGMSQIQRYGSEYDGAITGAPAFRYGQQQVNHLFSNVAEVMM
NYFPPPCEMDKIVNMTIAACDPLDGRTDGVVSRTDLCMLNFDMNSTIGAPYYCEASTSSS
LGFAFGQKVKRQMGQATADTPAQNGTVTAEGAALAAQLYSGMINSKGERVYLPWQPACSF
QDATTSYDNTTDTWGVDIASTGGEFVTKFIQKVDLDNLASLDNVTMDTLQGWMNDAMVLY
LDSLQTTLPDLTEFQESGGKLIHYHGESDDSVPTASSVRYYESVRSIMYPNQDFNASITS
LKEWYKLFLIPGAAHCSTNTLQPGPYPADNMATMIDWIENGVEPERLNATVGSGNYEGEV
QKLCAFPLRPIWDAEGTLSCEYDQASVDSWSYTLDAFKMPVY
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaatcgatgcgaacaggagctgttgcagctcttgcagcctctacagcaaaggcc
gcctcccttgcagatgtttgcactgtcgccaacgtccaagctgctttaccagcaaacgga
accttgaacggcatcaacccaatctcatcttccgttactgccaacactgtttacaacgcc
acagtcagctctgtagcctacgactactgcaacgttaccattacttatgcccaccctggt
aaagatcaagttgtagtttggtacaacttcccaagccccgatgtctacaagaaccgtttc
tatgttggcggtggaggtggatacgctctcagcgccgacccaactacaggtttaccatat
ggtgctgttggtggtgtctcagatgccgggtacgacgcaattggtggcactactgttgat
gaggttatattgactggaaatggatctgtcaactgggacagcatctacatgttcgcatac
caggcacttggtgagatgacccaacttggaaaggctattactccattgttctatggcagc
aactcaagcgcgaagctgtatacctactacgagggatgctctgatggtggacgtgagggt
atgtcccaaattcaacgttatggctctgaatatgatggtgccattactggtgccccagct
ttccgttatggacaacagcaagtcaaccatttattctccaacgttgccgaggttatgatg
aactacttcccccctccttgtgagatggacaagatcgtcaacatgacaatcgcagcttgc
gatcctctcgatggccgtactgatggcgtcgtatcccgaaccgatctttgcatgctcaac
tttgacatgaacagtactattggcgctccttactattgcgaggcctcaactagtagctcc
cttggatttgctttcggccaaaaggtcaagagacaaatgggccaagccactgccgatacc
cctgcccaaaacggaactgtcactgctgaaggtgctgctctcgctgctcagctctatagt
ggtatgattaactctaagggtgagcgtgtctacctcccatggcaaccagcttgttcgttc
caagatgccaccaccagctatgacaacacaacagatacatggggggttgatattgcatct
actggaggtgaattcgtaaccaagttcatccaaaaagttgacctcgacaatcttgcttcc
cttgacaacgtcactatggatacccttcaaggatggatgaacgacgctatggtcttgtac
ttggacagcttacaaacaactctccctgatctcactgagttccaagaatccggaggaaag
ctcattcattaccacggagaatctgatgacagtgtcccaaccgcctcttcagtccgctac
tacgaatccgtccgctccatcatgtaccctaaccaagacttcaacgccagtatcacctcc
ctcaaggaatggtacaagcttttccttattccaggggccgcccattgcagcaccaacact
ctccaaccaggtccttacccagccgacaacatggctaccatgatcgattggatcgagaac
ggtgttgagcctgagagacttaacgctactgttggtagcggtaactacgagggagaggtt
caaaagctttgcgctttcccattgagacctatctgggatgctgaaggcactttatcttgc
gagtatgaccaagcttccgttgattcctggtcttacactcttgatgctttcaagatgcca
gtctactag

DBGET integrated database retrieval system