KEGG   Botryotinia fuckeliana: BC1G_03226Help
Entry
BC1G_03226        CDS       T01072                                 

Definition
similar to NADPH cytochrome P450 oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 692 aa AA seqDB search
MGGQLDVLDIVVLGVLALGTIAYFTKGKYWGVVKDPYATSYAATNGNKPAKTRNITEKMD
ESNKNCVVFYGSQTGTAEDYASRLAKEGKSRFGLETMVADLEDYDYDTLDTFGEDKVAIF
VLATYGEGEPTDNAVDFYEYFMNEDVEFSSGEKSLANLKFVAFGLGNNTYEHYNSMVRNV
TKAFEKLGATRIGEAGEGDDGAGTMEEDFLAWKDPMWTALAEKMGLQEREAVFEPVFAIT
DREELTKDSSEVYLGEPNKMHLEGTSKGPYNAHNPYIAPISESKELFTVKDRNCLHLEID
ISGSNLSYQTGDHIAVWPTNAGREVDRFLDVTGLSSKKDSVITVKALDSTAKVPFPTPTT
YDAIVRYHMEICAPVSRQFLATLAAFAPNDAIKAEMEKLGGDKDYFHQKISNNYLNIAQV
LQEVGGQEKWSAIPFSAFIEGLGKIQPRYYSISSSSLVQKKKISITAVVESTDIPGRTDA
LKGVTTNYLLALKQKQHGDEHPDPHGLTYEITGPRNKYDGIHVPVHVRHSNFKLPSDPSK
PVIMIGPGTGVAPFRAFVQERAAQAKAGENVGRTILFFGCRKSTEDFMYKDEWKEYEEAL
GDKFSLITAFSREGKEKVYVQHRLKEHAKEINDLLMQKSYFYVCGDAANMAREVNTVLGQ
IISEQRGIPESKAEDIVKSMRSANQYQEDVWS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggtggacaacttgacgtcctggacattgtcgtccttggagttctagctctgggaacg
atagcatactttacaaagggaaaatactggggtgtcgtgaaggatccctatgctaccagt
tatgccgccaccaatggaaacaaacccgcaaagacaagaaacatcactgagaagatggac
gagtccaacaagaactgcgtcgtcttctatggttcgcagactggtaccgcagaagactac
gcttctcgattggcaaaggaaggcaagagtcgtttcggcttggagaccatggtggcagac
ttggaagactatgattatgacactctcgacacctttggagaagataaagtcgcaatcttc
gtattggctacatatggtgaaggtgaaccaaccgataacgccgttgatttctatgaatat
ttcatgaatgaagatgttgagttttctagtggtgagaaatcgcttgcaaacctcaaattt
gttgcatttggtctcggaaacaacacctacgaacactacaactcaatggtcagaaacgtc
acaaaggctttcgagaagctcggcgctacaagaattggtgaagccggtgagggagacgat
ggagctggtactatggaagaagactttttggcctggaaggatccaatgtggactgcattg
gctgaaaagatgggactccaggaacgtgaagctgtttttgaaccggtttttgctattaca
gacagggaagagttgacaaaggattcctcagaggtttatctcggcgagccaaacaagatg
catctagagggtacttcaaagggtccctacaacgctcacaacccttacattgcacctatt
tctgaatccaaggagcttttcactgtcaaggaccgaaattgtttgcacttggaaatcgat
atcagtggatctaacctcagctatcaaaccggagatcatattgcagtttggccaacaaat
gctggaagagaagtggaccgattcctcgatgttaccgggctctcttccaaaaaggattct
gtcattaccgttaaagcattggattcaactgcaaaggtcccattccctaccccaactaca
tacgatgctatagttagatatcacatggaaatatgcgcacctgtatcacgtcaattcctt
gccactttggctgcctttgccccaaatgacgccattaaggccgaaatggaaaagcttggt
ggtgataaagattactttcatcagaagatcagcaacaactatttgaatatcgctcaggtt
ttgcaggaagttggtggtcaagaaaagtggagcgccatcccattttctgctttcattgaa
ggtttgggcaagattcaacctcgttactactctatctcgtcttcctcgcttgtacaaaag
aaaaagatttccattacggcggttgttgagtcaaccgatattcctggaagaaccgatgct
ttgaagggtgttaccacaaattatctccttgcattgaaacagaagcaacatggcgacgaa
caccccgatcctcatggcctcacatatgaaatcacaggaccacgcaacaagtatgatggc
attcacgttccggtacacgtaagacactccaacttcaagcttccatccgatccatccaag
cctgtcatcatgattggtcctggaaccggtgttgcacctttcagggcatttgtccaagag
agagctgcacaagcaaaggctggcgaaaatgttggacgaacaatcttattctttggatgt
agaaagtctacagaagatttcatgtacaaagatgaatggaaagaatacgaagaagccctt
ggcgacaaattctcgctcatcactgcattctctcgtgagggcaaggaaaaggtctatgtc
cagcaccgtctcaaggaacatgccaaagaaatcaacgatcttcttatgcaaaagtcctac
ttctatgtttgtggtgatgccgcaaacatggctagagaagtcaatactgttcttggccaa
atcatctcagagcaacgtggcatcccagaatcaaaggctgaggatattgtaaaaagtatg
cgatccgccaatcaataccaggaggatgtgtggtcatag

DBGET integrated database retrieval system