KEGG   Botrytis cinerea: BC1G_03734Help
Entry
BC1G_03734        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     BC1G_03734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 573 aa AA seqDB search
MVSTSSQAPPPHKKQRSKERQPDWDKFYENGLPKEVIVIDSSESPEPSLGISSHIQANNS
VVAATNGHAAKKRKRNDAYDPVYQLDPSIDPSPHYKSESGSGSTISTDRTTSAIHTTAAT
SLGSHSSNGQNGYEAAEAIGQKRKRTNTRLQIANEAKRKELEINGDAFTNYIPPPKPPIK
SRDVPVRPIADNSYTKNTKIDDDDGHYIVVPETNLTAQYQVQKLLGQGAFGKVVQAKDLQ
NDKCVAIKIIRSVQKYRDASKIELRVLSTLKANDRENRNRCIHLRDCFDYRGHICIVMDL
LGQSVFDFLKGNSFVPFPNSQIQHFARQLFTSVAFLHDLNLIHTDLKPENILLCNSAYQA
FTYSRKIPSSSSTVTRQAAQRKVLLDTEIRLIDFGSATFQDEYHSSVVSTRHYRAPEIIL
GLGWSFPCDIWSIGCILVEFFTGDALFQTHDNLEHLAMMEAVVDKKIDSHLVQQVNTMAK
RNGGNPAQKASRRFVKAMKPLHEIIKDQSKFSKNFLDLLRKIFVYDPNERITAKEALQHP
WFKEAATADDGTEAAKIRLQRQSGTFVAPQRHH
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggtttctacctcatcgcaagcgcctcccccgcacaagaaacaaagatcgaaggagaga
cagccagactgggataaattctacgagaatggtttacccaaagaggtaattgtcatcgat
agttctgaatccccagaaccatcgttgggcatttcctcgcatattcaagccaataattct
gtcgtggcagcgactaatggccatgcggcgaagaagagaaaacgcaatgatgcatatgat
cccgtataccaacttgacccctcgatcgatccgagtccacactacaaatcagaatcgggt
tctggttccacgatatccaccgatcgcacaacatcagcaattcatacaaccgccgctaca
tcccttggttcacattcatctaatgggcaaaatgggtacgaggctgcagaagctataggg
cagaagaggaaaaggaccaatactcggttgcagattgccaatgaagccaagaggaaagaa
ttagaaatcaatggggatgcatttaccaactacataccacctcctaagcctccaataaaa
tctcgcgatgtcccagtacgaccgattgcggataactcttataccaagaataccaaaatc
gacgatgacgacggacattatattgtcgttccagaaacgaatctaacagcacaataccag
gttcaaaaattacttggtcaaggagcctttggaaaggttgtacaagctaaagatcttcaa
aatgataaatgtgttgctatcaagatcattcgctctgtgcagaaatatcgggatgcttcg
aaaatcgagttacgagtcctctcaacactcaaagcaaatgatcgtgagaaccggaacaga
tgtatacatctacgggattgtttcgattacagaggtcatatatgtatagtcatggatctt
ttggggcagagtgtgttcgatttcttgaagggcaattccttcgtaccctttcccaattct
cagattcaacattttgcgcgacagttatttacgagcgttgcctttctccacgacttaaac
ttaatccacacagatctcaagccggagaatatcttattatgcaacagtgcatatcaagct
tttacatacagccgcaaaattccttcttcttcaagtacagtcacccggcaagcggcacag
cggaaagttcttctggatacagaaattcgactcattgattttggttccgcaacctttcag
gatgaatatcactcatctgtcgtatccacacgacactaccgagctcctgagattattctt
ggtctgggttggtctttcccatgcgatatctggagtattggatgcatacttgtcgaattc
ttcacgggagacgcccttttccaaacacacgacaatctggagcatttggccatgatggaa
gccgtagtcgataaaaaaatagatagccatctcgttcaacaagtcaacaccatggcaaaa
cgaaatggaggaaatccagcacaaaaggcttcacggagatttgtgaaggcgatgaaaccc
ttacatgaaatcattaaggatcagtcgaaatttagcaagaatttcctggatctactgaga
aagatatttgtctatgatccaaacgaacgtattacagccaaggaggcgcttcaacacccg
tggtttaaggaagccgcaacagcagatgatggtacggaagcagcgaaaattagactacag
aggcaaagcggaacatttgtagcgccacagaggcatcattga

DBGET integrated database retrieval system