KEGG   Botrytis cinerea: BC1G_03758Help
Entry
BC1G_03758        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
bfu  Botrytis cinerea
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC1G_03758
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     BC1G_03758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 917 aa AA seqDB search
MFKPFRPPLLKSVPKPSKPVDEFSDVQVISDSEEEILTKPAAKKRRLLIHNVEEAPKIKA
PITSSAANAPRKPLMVVKNPVEATQAPTPSENPSSIDGYYLVLWRKFTMKKHKTWEGTEY
SQSPEDTPDFKILMVEIWAAASDSHSSPAARPPPHPTLSNISKNNSTSTLGKRKDSGLGS
AIPAKTFYASTPKSDAVKSQFKNPLLATTVMPQNKSGTPTPRHDPSVPGAIVMQRPNPKY
VAKGKQVVDVVVDPFLGRHLRDHQKEGVKFLYECVMGYRSFNGQGAILADEMGLGKTLQT
IALLWTLLKQNPEHPHEGGVIKKALIVCPVTLISNWKAEFNKWLGNERIGVFVADGSKNI
RLTDFTHGKSYSVMIIGYEKLRTVQEELKKGSGIDIVVADEGHRLKTAANKSAQAIKNLN
TERRVILSGTPIQNDLSEFFTMVDFVNPGLLNGYNTFKKCFEAPILKSRQPGATESDMEK
GTAREEELAELTKLFILRRNASILAKYLKPKTEYVLFCKPTQAQAEVYQHVLASPVFGRV
LGSSEASLQLITMLKKVCNAPSLLVKKSDTDTPSNSNVAQLLESIPPEILKKNPVVASSK
FRVLNRMLMRLSKSTTEKIVIVSNYTSTLDLLVSHLSSLNLPFLRLDGSTPQAKRQDLVN
TFNKTPASKYFAFLLSAKSGGAGINLIGASRLVLFDVDWNPATDLQAMARIHRDGQKRPV
KIYRFLMSGGMDEKIYQRQVTKMGLADSVMDGKKNEASFSADELRDLFRLDVNAQCQTHE
LLGCDCGGVGREEPVVSASEMPEPNKEISASEEDEEDDDDEFPINPACSLVPATKANVEA
QQKIALEATKGKRSKKGKKMQALMEYRHIDTSMFHVKSADSIGTEVDDVKQSLDDEVLLS
VLEDERCKVCYVFAKKG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaccattccggcctccactcttgaagagtgtgccgaaaccttctaagccggtc
gatgagttctcagatgtccaggttatatcagattccgaggaagaaattttgaccaaacca
gctgcaaagaagagacggcttctgattcacaatgttgaggaggctccaaagattaaggct
ccgatcacatcttcggctgccaatgcgcctcgaaaacctttgatggttgtaaagaatcct
gttgaagcaactcaagcccctactccatctgaaaatccaagtagtattgacggatactat
ttggtactatggcgcaaattcacgatgaagaaacataagacctgggaggggacggaatac
tcgcagtcaccggaggatacgcccgacttcaaaatattgatggtagagatatgggccgct
gcatcagacagtcatagcagtccagccgcacgacctccgcctcatccaaccctatcaaat
atatcgaaaaacaattctacgagcacacttgggaagaggaaagatagtggcttaggctcg
gcaattcctgccaaaaccttctatgcctctactccgaaaagtgatgcagtcaaatcccaa
ttcaagaatcctcttctagcaacgacggtcatgccacaaaataaaagcggtacgcctact
ccccgtcatgatccctctgtaccaggggcaatcgtaatgcaacggccaaaccctaagtat
gttgcgaaaggcaagcaagttgtggatgttgtcgtcgatcccttcttgggtcgccattta
cgtgatcatcaaaaggagggagttaagtttttgtacgagtgcgttatgggctaccgttct
tttaatgggcagggtgcaatcttagctgatgagatgggtctgggaaagacactgcagaca
atcgcgctgttatggacattattgaagcaaaatccggagcatccacacgaggggggcgtc
ataaagaaggccttgattgtctgtcctgtaactcttatctccaactggaaagcagaattc
aacaagtggcttggtaatgaaagaatcggcgtttttgttgccgatggatctaaaaacatt
cgacttactgatttcactcacggcaagagttacagcgtcatgatcatcgggtacgagaag
ttacgcacagtgcaagaagagctaaagaaagggagtggaatagatatagtcgtagctgat
gaagggcaccgtttgaagactgctgcgaacaaatcggcgcaggcaatcaagaatttgaat
acggagagacgagttattctatctggaacacccatacaaaatgatctgtcggagttcttc
acaatggtagactttgtgaaccccggtcttctcaatggctacaatactttcaaaaaatgt
ttcgaggccccaatattgaaaagcagacagccaggtgctacagagagcgacatggagaaa
ggaacggctcgagaagaggagttggctgagttgacaaagttattcatattacgtcgcaac
gccagcatacttgcaaaatacttgaagccaaagacagaatatgtattgttctgcaagccc
acgcaagctcaggctgaagtgtatcagcatgttcttgcctctccggtcttcggtagagtc
cttggcagctcagaggcctctctacagcttatcaccatgctcaagaaagtctgcaacgct
ccgagcctccttgtcaaaaagagtgatacagatactcctagcaattcaaacgttgctcag
cttctagaaagcatacctcccgagattctcaagaaaaatccagttgtggcaagcagtaaa
ttcagagttttaaatcgtatgctcatgcggctttcgaagtcaactactgaaaagatagtt
attgtctccaactacacttctactctcgacctgttggtgtcacacctttcgtcattgaac
ttaccctttctgcgcctcgatggtagcactcctcaggcaaaacggcaggatctagtaaac
acgttcaacaagacacctgcatcgaaatattttgcctttctgctttcggctaaatctggc
ggtgccggtataaacctgattggggcctcacgcctcgtactgtttgacgttgactggaat
cctgctaccgaccttcaagccatggcacgtatccaccgcgacgggcaaaagcgtccagtc
aagatatacaggtttctgatgtcgggaggcatggatgaaaagatataccagcgacaagtt
accaagatgggactcgccgacagtgtcatggatggcaagaagaacgaagcgagtttctca
gccgatgagctgcgagatctctttaggttggatgtaaatgcgcaatgccaaactcacgaa
ctcctaggttgcgattgtggaggggttggtcgcgaggagccagttgtatcagcatctgag
atgccggagcccaataaagagatcagtgccagcgaagaggatgaagaggacgacgatgat
gagttccctatcaatccagcttgttctctggtgccagcaactaaagcaaatgtggaggcc
cagcaaaagattgctctagaagccactaaaggaaaacgatccaagaaaggaaagaagatg
caagcgttaatggagtacagacacattgatacttcaatgttccatgttaaatcggcagat
tcgattggtacagaggtagacgacgtaaaacagtctctagatgacgaagtcttactttca
gttctagaggatgaaagatgtaaagtttgctatgtttttgctaagaaaggatag

DBGET integrated database retrieval system