KEGG   Botrytis cinerea: BC1G_03886Help
Entry
BC1G_03886        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BC1G_03886
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     BC1G_03886
    3.1.1.84  cocaine esterase
     BC1G_03886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 536 aa AA seqDB search
MKQFTSQVLGAAALAHGASAQLYNQVIQTNYGPVQGIPAFNSSPNGNISNWEDITVWKGI
PYGADTSGENRWTAPKNATPWNTTLQASKMGPICGPGNPSTTGGTVSEDCLNLNIWSNGN
STDAKLPVVFWSFPAGGAADQPLFDGAGMASQGIVFVNYNYRISALGWLSTPELSEEMYK
ATGSNSSGNWGQLDQIHALKWVHANIAAFGGDPDHITVMGQSAGSAAVYHFVNSPLTKGL
IVGAIAESGTRDPYDPEALTLAENYRNQSYALESGLAYMASKNVSTIAEMRALPLADLEE
PLFGSTFSDNFGNVLDGYAIPAKYIETLATGPANDVPYITGNTKDESGAATSTNLTVAEY
EAEIEAQYGAYNLSSTFLELYPASNTTQASMAYNAHWRDTSRVSSWSFANRWSVKSKSPF
WTYYWDHAPPGQDQGAYHESEINYVLNNLYGTDKPWEAVDFEIALKMNGYWANFAKTLNP
NNGGSYRGNGTLPQWNANSKTDMVTMEVGDGFGEVPIGSADQVAAITKYFSFQNPV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttacttctcaagtccttggggctgccgctctcgctcatggtgcctcagca
caactttacaaccaagtaattcaaaccaactacggacctgttcaaggtattcctgccttt
aactcttccccaaatggcaacatttcaaactgggaggatatcaccgtatggaagggtatt
ccatatggtgccgatacctctggcgagaaccgatggacggctccaaagaatgcaacacct
tggaataccactcttcaagccagtaagatgggtccaatttgcggaccaggtaacccatct
acaactggtggaactgttagcgaagactgtttgaacctcaatatttggtctaatggtaac
tctaccgacgccaagcttccagttgtcttttggtcattccctgcaggtggtgctgccgat
caacctttgttcgacggtgccggaatggcgtctcaaggcattgtgtttgtcaattacaac
taccgtattagtgctcttggttggctttcaaccccagagctttcggaggaaatgtacaaa
gctactggatctaacagttccggaaattggggtcagcttgatcaaatccacgctttgaaa
tgggtgcatgccaacatcgctgcattcggtggtgatccagaccatatcaccgtcatgggc
caatccgctggctcagctgctgtctaccacttcgtcaacagtccattgacaaaggggctc
attgtcggagccatcgccgagtcaggaacccgtgatccatacgatcctgaggcccttact
cttgctgagaattatcgcaaccagtcttatgctctcgagtctggcttagcatatatggca
tccaagaatgttagcaccattgctgagatgcgagctctccctctcgccgatctcgaagaa
cctctcttcggatccactttctccgacaacttcggcaatgttcttgatggctatgctatc
cccgccaaatacattgagacacttgccactggcccagcaaacgatgttccatacatcact
ggaaacaccaaagatgaatccggagcagctacaagcactaatctcacagttgccgagtat
gaggccgaaatcgaagcacaatacggtgcttacaatctctcatccacattcttggaactt
tacccagcttcaaacaccactcaagcaagtatggcgtataatgctcattggcgcgatact
tctcgtgtctccagttggtctttcgccaaccgctggtctgttaagtctaagtcacctttc
tggacatactactgggatcatgctcctccaggacaagatcaaggcgcttaccatgagtct
gaaatcaactatgttcttaacaatctgtacggaaccgacaagccatgggaagctgttgat
ttcgaaattgcgctcaagatgaacggatactgggcgaacttcgcaaaaactttgaaccct
aacaacggaggctcttacagaggaaatggaaccttgccacaatggaatgccaattccaag
acggacatggtgactatggaagttggagatggatttggagaggttcctattggcagtgca
gaccaagttgctgctattaccaagtacttttccttccaaaaccctgtttag

DBGET integrated database retrieval system