KEGG   Botrytis cinerea: BC1G_04286Help
Entry
BC1G_04286        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bfu  Botrytis cinerea
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BC1G_04286
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BC1G_04286
Transfer RNA biogenesis [BR:bfu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BC1G_04286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 332 aa AA seqDB search
MSNYSKELEVAQLAVQRAAILTKKVFHEKSKGTLSKDDKSPVTIGDFGAQALIIQAIKKN
FPDDEVVGEEEASDLRENSQLRDQIWELVEASKLSDPEAEKVLGGPVESVDAMLDAIDAG
NSAGGAKGRIWALDPIDGTKGFLRGGQYAVCLALMVDGDVKVGVLGCPNLPVDDSAPLSA
DAGKDASDDEGKGVLFSAVLGQGATSRPLGTGALGKGQSIQMKPVTDLTQATFCESVEAG
HSSHGDQHAIATKLGVTKASVRMDSQAKYGSIARGAGDIYLRLPVSATYQEKIWDHAAGD
LIVREAGGQVTDSVGRCCCSSNGHSQSCFRSS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactacagcaaggaattagaagtggcccaattggccgtccaaagagcagctatc
ttgaccaaaaaggtcttccatgaaaaatcaaaaggaactctatccaaggacgacaaatca
ccagttacgattggagattttggagcccaagctttgattatccaagcgatcaagaagaac
ttccccgacgatgaggttgtgggagaagaggaagctagtgacttgagagaaaattcgcaa
ttgagagatcagatttgggaattggtcgaagcttcgaaactttcggacccggaggctgag
aaggttttggggggtccagtggaaagtgtggatgctatgttggatgctatcgatgctgga
aacagtgctggtggagccaaaggaaggatttgggcgttggatcctatcgatggaaccaag
ggatttttgagaggtggccaatacgccgtttgcttagcattgatggttgatggagatgtc
aaggtcggtgttcttggatgccctaaccttccagtcgatgattccgctccattatccgct
gatgctggtaaggatgcatcagatgatgaaggaaagggtgtcttattctccgccgtattg
ggacaaggtgctactagccgaccattgggtactggagcactaggaaaaggacaatctatt
cagatgaagccagttacggacttgacccaagctaccttctgtgaaagtgttgaagccggt
cactcttctcacggcgaccaacatgctattgctaccaaattgggtgtcaccaaagccagt
gtccgcatggattcccaagccaaatacggctcaattgccagaggtgctggagatatctac
ctcagacttcccgttagcgcgacttaccaagagaagatttgggatcatgcggctggagat
ctcatcgtgagagaagccggtggacaagttaccgattccgttggacggtgttgttgcagc
tccaacggccattcacagtcatgttttagaagtagttaa

DBGET integrated database retrieval system