KEGG   Botrytis cinerea: BC1G_04386Help
Entry
BC1G_04386        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
bfu  Botrytis cinerea
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    BC1G_04386
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     BC1G_04386
Peptidases [BR:bfu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BC1G_04386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 899 aa AA seqDB search
MSPAAVGGPHLRTTSINGTGPINNIKKDGVNGMGTLSGSGRVLPHLDDLVNAKPLVDRQS
SLRKLLEAGEEAAKHAETYLDFKRLDLALQQYIIAFTIAVEYIPQSPHYPDLRSRSDYTR
LYAGLQKRLNTQHNRFEEVKKIIKEDNTRTGVSPSSLLPYNGESVPGNTNSIALKPAISD
VNSNASNRKIETRQKPVIQPKPQGLHGNSIQTANGISSSLPNSSESDLAARFARLRSPNA
INLTQDPRIRTQQITIPDETTIDQKPTNSTSQYKQNASILRPLGPREMPMSPATLKTEKP
ILDMDTSVPMMPRMPDAIYSPARSTDVVSTNSQPPMLSRGSSYFNGKREHSSSVTKVTRN
RIVVDDATDYFSNSEVNNYTFDHGHPEPETRIDKPSIPNTTTITAEQLHGFLKMGSKTLS
ILIVDIRSREEFNEGHIMASSIICIEPIALRKDMSAEDLGEGIVLSPESEQRLYDQRHIF
DLIVYYDQSSMPINTEHAPGEPLNHLQHFSKIIYDHAYDHRLKRRPMLLVGGLDSWIDLF
GPNVLKSEIPGNKSLVRNKKHDHQGLGRVSITREARRGLAAKRTTPRLRNLSAAEEEKWD
QALKQNSDDESPAQDSAMDESYYARTTDDFMRRYPELPSVKQSMASPSMPRSLPLYDGSK
ISAPPTRPPPALPRQRSNGIFEQTPYKNYAMTGGNSSAPPSIDPGLCGLRNITGGLCYMN
AVVQAIGSSPAIRNMFIKFQYPCIPEIPKKPGEDSPPMLLMTRALRSLLQHMWCGKYDEI
VPRMFQQYVHATAVGHEGYIGVDQTRMGERDHRPDTTFGTSRQHDANEFLAWLFDVIMDE
QNIHRDRTGLLGDVSTFSTKEKSELPRTQNCREGYERALETLNSPLAKLVCNQKMTGLR
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgagtccagcggccgtcggtggcccccacctgcgaaccacttcaatcaatggaactggg
ccaataaacaatataaagaaagatggcgttaatggcatgggaactttgagtggcagtggt
cgagtactgccacatctagacgatttggtgaatgcgaaaccacttgtcgatagacagtcc
tcgttacgaaaattgctggaagctggcgaagaagctgcaaaacatgcggaaacataccta
gactttaaacgcctggacttagctcttcaacagtacatcatagcctttacaatagccgtg
gaatacattcctcagagtccgcattatccagatctaaggagtaggtcggattacacccga
ttatacgctggcttgcagaaacgactcaatacacaacataatagattcgaggaagtcaag
aaaataatcaaggaggataatacaagaactggagtcagcccgtctagtttacttccatac
aatggagaatctgttcctgggaataccaatagcattgcattaaagccagccatatccgat
gttaatagcaacgcaagcaatagaaagattgaaacccgtcaaaagccagtgatacaaccg
aaaccacaaggacttcatggcaattcgatacaaacagcaaatggcatatcgtccagtctg
cccaactcatccgagagtgacttggccgcaagatttgcccgtttgaggagtccaaatgct
ataaatcttactcaagatcctaggattagaacccaacaaattactattccagatgaaacc
acaatagatcaaaaaccaaccaattcgacatcgcagtacaagcaaaatgcgagtatattg
cggcctctgggcccaagagaaatgccaatgagtccagcaactctcaagacagaaaagcca
atccttgacatggatactagtgttcccatgatgccaagaatgccggatgcaatctatagt
ccagcacgcagtacagacgtggtttcgactaacagtcaaccgccaatgttgtctcgaggg
tcttcctactttaacggaaaaagagagcattctagttcggtcacgaaagttactcgcaat
cgaatcgtggttgacgatgcaaccgattatttctcaaactctgaggtcaataattacaca
tttgatcatggtcatcctgaacctgaaacccggattgacaagccatcaatacccaacacc
acaaccattactgccgagcagcttcatggttttctcaaaatgggctctaaaactttgagt
atcttaattgtggatattcgaagcagagaagaattcaatgaggggcatatcatggcctca
tcaattatctgcattgaacctatagctctacgaaaagatatgtccgcagaagatcttggg
gagggaattgttttatctcctgaatccgaacaaaggttgtacgatcagaggcatatattt
gacttgatagtctattacgatcaatcgtcgatgccaataaacacagaacatgctccaggc
gaacctcttaatcatttgcaacatttcagtaaaattatctacgatcatgcttacgatcat
cgattaaagcgacgaccgatgttactcgttggtggtctagactcttggatagacctcttt
gggccgaatgtattaaagagcgaaatccctggcaataaatctctggtcagaaacaagaaa
catgaccatcaaggtttgggtcgagtttctattacacgtgaagctcgaagaggcttagcc
gcgaagagaacaacacccagattacgaaatttatcagcggcagaggaagagaaatgggat
caagctttaaaacaaaattctgatgatgagtcacctgctcaggattctgctatggacgaa
tcttattatgccagaactactgatgactttatgaggagatacccagagcttccatcagtc
aagcaatccatggcctcgccatcaatgccgaggtcattgcctctctatgatggatcaaaa
atttcagccccgccaactcgtccaccaccagctctaccaagacagagatctaatggcatt
ttcgaacagacaccatataagaattatgccatgacagggggaaattccagcgccccaccc
tcaatagaccctggtctatgtggtttgagaaacatcacaggtggtctctgttacatgaat
gccgttgttcaggccattggttcctcgccagcaataaggaacatgtttattaagttccag
tatccttgcattccggaaattccgaaaaagccgggcgaagatagccccccgatgctgttg
atgactcgtgctctgcgcagtttgctgcagcatatgtggtgtggaaagtacgacgagatt
gttccaagaatgtttcaacaatacgttcatgcaaccgccgttggccatgaaggttatata
ggcgttgatcagactcgcatgggtgaacgtgaccacagacccgatacaacttttggaact
tctagacagcatgatgccaacgagtttttagcatggctctttgatgtcatcatggatgag
cagaatatccatcgtgacaggactgggctcttaggtgatgtctcaactttttctacaaag
gagaaaagtgaattgccaagaactcaaaattgtcgcgaaggatatgaaagggcccttgaa
acgttgaattcaccccttgcaaaacttgtctgtaaccaaaagatgactggattgcgatga

DBGET integrated database retrieval system