KEGG   Botrytis cinerea: BC1G_04447Help
Entry
BC1G_04447        CDS       T01072                                 

Definition
(RefSeq) similar to mutant tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
bfu  Botrytis cinerea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1G_04447
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1G_04447
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1G_04447
Enzymes [BR:bfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BC1G_04447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 579 aa AA seqDB search
MEHLKRTFAQCKKEGRSALVTYITAGFPQAHDTVDILLGMEAGGADVIELGIPFTDPTAD
GPTIQKANTQALKNGITVTSVLQMVRDARKKGLRAPVLFMGYYNPFLSYGEERLLKDCRE
AGVNGFIVCDLPPEEAVSFRKFCTSGGLSYVPLIAPSTSESRMKLLCKLADSFIYVVSRM
GVTGATGGSMDAGLEGLLKRVKEYSGNVPAAVGFGVSTRDHFLQVAKIADGVVIGSQIIN
TVNQAPAGKIAKSVEEYCAEVCGRRGAPSDGEGLTREVGMAETMNVAQEPSGENVTVDAV
IRDEDRSGPGLADQIEALNTNGPIDPKIASQKFGEFGGQYVPEALMDCLSELEAGFNAIK
DDPAFWEEYRTYYPWMGRPGQLHEAERLTEHAGGAKIWLKREDLNHTGSHKINNALGQIL
LARRLGKTEIIAETGAGQHGVATATVCAKFGMKCTIYMGAEDVRRQALNVFRIKLLGASV
VAVEAGSRTLRDAVNEAMRSWVVKLDTTHYIIGSAIGPHPFPTIVRTFQSVIGNETRAQM
LEKRGKLPDAVVACVGGGSNAGGMFYPFSKDPSVILVWC
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctaaagaggacattcgcacaatgcaagaaggaaggaagatccgcattggta
acatacattactgcgggcttcccccaagcacatgatactgttgatatcctattgggaatg
gaggctggtggtgccgatgttattgaattaggcattcctttcacagaccctactgcggat
ggacccacgattcaaaaagcaaatactcaagctttgaagaatggtatcacagttacttcg
gttttacaaatggtacgggatgcaagaaagaagggattaagagccccggttcttttcatg
ggttactacaacccttttctgagttatggagaggaaagattgttgaaggactgccgagaa
gctggtgtcaatggattcattgtttgtgatcttccaccagaagaagctgtgagcttcaga
aagttttgcacaagcggaggattatcctacgttcctctcatcgctccttcgacttccgaa
tcccgaatgaagcttctttgcaagcttgcagactctttcatatatgttgtttcaagaatg
ggtgtcactggagccacaggaggttcaatggatgctggtttggaagggctattgaaaaga
gtcaaggaatactcaggaaacgttccagccgctgtaggattcggtgttagcacaagagac
catttcttacaggtcgccaaaattgccgatggagtcgtcatcggaagtcaaattatcaac
acagtcaatcaagcacctgccggcaaaatcgcaaagagtgtcgaagaatactgcgcagaa
gtttgcgggagaaggggcgctccaagtgatggagaaggtctaaccagagaggttggaatg
gctgagacaatgaatgttgcccaagagcccagcggagagaatgttaccgtcgatgctgtc
attagggatgaagacagatctggacctggtttggctgatcagattgaggccttaaatacc
aatggccccatagatccaaaaattgcatctcaaaagttcggagaatttggcggacaatac
gtaccagaggcgcttatggattgtttatcagagcttgaagcaggattcaatgcaatcaag
gacgatccagcattctgggaagaataccgaacatattatccatggatgggacgaccaggt
caattacatgaggctgaaagacttactgagcacgctggcggtgcaaagatctggttgaag
agagaagatctgaaccataccggaagtcacaagatcaacaatgctttgggacaaatcctt
cttgctcgacgattaggaaagaccgaaattatcgcagagactggtgcaggacagcacggt
gtggccacagccactgtgtgcgcaaagttcggtatgaaatgtaccatttacatgggagct
gaagatgtaagaagacaagctctcaatgttttccgaattaagcttcttggtgcatcagtt
gtcgccgtcgaagctggttcgcgtacactccgagatgctgttaatgaagctatgcgctct
tgggtcgtcaagcttgacactactcattacatcattggctcagcaattggtcctcaccca
ttcccaactatcgtcagaacatttcaatccgtcatcggcaacgaaactcgagctcaaatg
ctagagaagcgtggtaaacttcctgatgctgtcgttgcatgcgttggaggcggtagtaat
gcgggtggcatgttctacccattctcaaaagacccaagtgtcatattagtttggtgttga

DBGET integrated database retrieval system