KEGG   Botryotinia fuckeliana: BC1G_04810Help
Entry
BC1G_04810        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 271 aa AA seqDB search
MAPILNFALALAMPILSLAAALPTGAELENRATTLGGTPDIVGGTTAALGEFPYIVSLSY
SGSHFCGGVLLNAYTVLTAAHCSVSYSASSVKVRAGTLTWASGGTQVGVSKVVVHPSYSS
STTNNDIALWHLSTALPASSTIGYAKLPVQGSDPVVGSTTTVAGWGLLTENGSTLPSTLR
KVSVPVISRASCQAEYGTSAVTTNMWCAGYAAGGKDSCSGDSGGPIIDTATGVLEGTVSW
GQGCAEAGYAGVYARVGNYVTYINSNLWTSL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaattctcaacttcgcgctcgctcttgcgatgcccatcctttcgttggcggct
gctcttccaaccggagctgagctcgaaaaccgtgctaccactctcggaggaactccagat
attgtcggaggaaccaccgctgctcttggtgaattcccctacattgtcagcttgtcctac
agcggctctcacttctgtggtggtgtcttgctcaacgcctacaccgttcttactgcagct
cattgctctgtcagctactcagcttcctcagttaaagttcgcgctggaactttgacctgg
gcatctggcggaacccaagttggtgttagcaaggttgtagtccacccatcctacagttcc
tccaccaccaacaacgacattgcactctggcatttgtcgactgctctcccagccagctcc
accatcggctacgctaagttgcccgttcaaggctcggaccctgttgttggttctaccacc
actgttgcaggatggggtcttttgactgagaacggatccacattgccatcaactttgaga
aaggtctcggttccagtcatctcccgtgcttcctgccaagctgagtacggtacatccgct
gttaccaccaacatgtggtgtgcaggatatgctgcaggtggcaaggattcctgctctggt
gactctggtggaccaatcatcgatactgccactggtgttttggagggtactgtttcctgg
ggtcaaggttgtgctgaggctggttacgctggtgtctacgctagagttggtaactatgtt
acttacatcaactccaacctctggactagcttgtaa

DBGET integrated database retrieval system