KEGG   Botrytis cinerea: BC1G_04810Help
Entry
BC1G_04810        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     BC1G_04810
Peptidases [BR:bfu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   BC1G_04810
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1G_04810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 271 aa AA seqDB search
MAPILNFALALAMPILSLAAALPTGAELENRATTLGGTPDIVGGTTAALGEFPYIVSLSY
SGSHFCGGVLLNAYTVLTAAHCSVSYSASSVKVRAGTLTWASGGTQVGVSKVVVHPSYSS
STTNNDIALWHLSTALPASSTIGYAKLPVQGSDPVVGSTTTVAGWGLLTENGSTLPSTLR
KVSVPVISRASCQAEYGTSAVTTNMWCAGYAAGGKDSCSGDSGGPIIDTATGVLEGTVSW
GQGCAEAGYAGVYARVGNYVTYINSNLWTSL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaattctcaacttcgcgctcgctcttgcgatgcccatcctttcgttggcggct
gctcttccaaccggagctgagctcgaaaaccgtgctaccactctcggaggaactccagat
attgtcggaggaaccaccgctgctcttggtgaattcccctacattgtcagcttgtcctac
agcggctctcacttctgtggtggtgtcttgctcaacgcctacaccgttcttactgcagct
cattgctctgtcagctactcagcttcctcagttaaagttcgcgctggaactttgacctgg
gcatctggcggaacccaagttggtgttagcaaggttgtagtccacccatcctacagttcc
tccaccaccaacaacgacattgcactctggcatttgtcgactgctctcccagccagctcc
accatcggctacgctaagttgcccgttcaaggctcggaccctgttgttggttctaccacc
actgttgcaggatggggtcttttgactgagaacggatccacattgccatcaactttgaga
aaggtctcggttccagtcatctcccgtgcttcctgccaagctgagtacggtacatccgct
gttaccaccaacatgtggtgtgcaggatatgctgcaggtggcaaggattcctgctctggt
gactctggtggaccaatcatcgatactgccactggtgttttggagggtactgtttcctgg
ggtcaaggttgtgctgaggctggttacgctggtgtctacgctagagttggtaactatgtt
acttacatcaactccaacctctggactagcttgtaa

DBGET integrated database retrieval system