KEGG   Botryotinia fuckeliana: BC1G_05075Help
Entry
BC1G_05075        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 581 aa AA seqDB search
MATTVDTMTLSDRQRKPKDPNLPPENERYLRACSDIASALVQDHESQQDPNAPRKDINLN
SLRAKMSKRHRLSNIPPLTAIIAAIPEHYKKYILPKLIAKPIRSASGIAVVAVMCKPHRC
PHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLG
HSVDKVEYIIMGGTFMSLSESYRDGFISQLHNALSGYQGNNVDEAVQAGEMSNIKCVGIT
IETRPDYCLQPHLSAMLRYGCTRLEIGVQSLYEDVARDTNRGHTVASVAETFCLAKDAGF
KVVSHMMPDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKN
YTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALSRMKDFGTTCR
DVRTREVGINEVKNKIRPSQVELVRRDYTANKGWETFLAYEDPKQDILIGLLRLRKCSKT
HTFRPELTGQPTSIIRELHVYGSAVPVHARDPRKFQHQGYGTLLMEEAERIARNEHGSTK
ISVISGVGTRDYYRRLGYWLDGPYMSKMLPPKDDEDSDDDF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggccactaccgtcgatacaatgacattgtcggataggcaaagaaagccaaaggaccct
aatttacctccagagaatgaacgatacttgagagcatgttcagatattgctagcgcattg
gtacaggatcatgaatctcaacaggatccaaatgcgccgaggaaggatatcaatttgaat
agtttaagggccaaaatgtcgaaacgtcacaggctcagcaatattccaccattgactgct
attattgccgccattccagagcattacaagaaatatatccttccaaagttaatcgcaaaa
ccaattagaagtgcttctggtattgcggttgtcgcggttatgtgcaaaccacatcgatgt
cctcacattgcctacacaggaaacatctgtgtctactgtcccggtggacctgattccgat
ttcgaatattctacacaatcatatactggttatgaacctacatcaatgagagccatccga
gcacgatacgatccttttgaacaagctcgaggaagagtagatcaaattaaatcgctcggc
cacagcgtcgacaaggtagaatacattattatgggtggtactttcatgtcattatctgaa
agttacagagatggttttatctcccagctacacaatgcgcttagtggatatcaaggaaat
aatgtagatgaagcagttcaagctggtgagatgagcaacatcaaatgtgttggtatcaca
atcgaaactcgtccggattattgtttacaaccccatttatctgccatgctaagatatggt
tgcacccgtttggaaattggtgtacaatcactgtacgaggatgttgctcgagataccaac
agaggtcacacagtggcttcagtcgcagaaacattttgtttagcgaaggacgctggcttc
aaggttgttagtcatatgatgccagatttacccaatgttggaatggagagagatttggat
caatttagggaatatttcgaaaaccccgccttcagaaccgatggtctcaaaatttaccca
acattggtcattcgtggaactggcttatacgaactctggagaactggcaggtacaagaat
tacacaccaaatgccttgatcgatatagttgctcgaatcctcgctcttgtaccaccgtgg
actcgtatttatcgtgtccaaagagatattccaatgcctttggtcacatctggtgttgag
aatggaaatcttcgagagcttgcgttgagtagaatgaaggattttggtactacttgtcgt
gatgttcgaactcgtgaagtcggtatcaatgaggtcaagaataagattcgtccttctcag
gttgaacttgttcgaagagattataccgcaaataaaggatgggagacatttttagcatat
gaagatccaaagcaagatattcttattggattgcttcggttaagaaagtgttctaaaaca
cacacctttagacccgagcttactggacagcctaccagtatcattcgtgagcttcacgtt
tatggttcagctgttccagttcatgctcgcgatccaagaaagtttcaacatcaaggttat
ggtacattactcatggaagaagctgaaagaattgcccgaaatgaacatggaagtacgaag
ataagtgtcatcagtggtgttggtacaagagattattatcgaagattaggttattggttg
gatggtccttacatgagtaagatgctgccaccaaaggatgacgaggatagtgatgatgac
ttttga

DBGET integrated database retrieval system