KEGG   Botrytis cinerea: BC1G_05268Help
Entry
BC1G_05268        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bfu  Botrytis cinerea
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BC1G_05268
  Amino acid metabolism
   00380 Tryptophan metabolism
    BC1G_05268
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BC1G_05268
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BC1G_05268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1072 aa AA seqDB search
MPLALDAQRGNLHVDTFIATTCPRTVVCGDLCKMTTAIPGPKAKPLVGNLLDLKDEEAPL
RALEHLAVEYGPIYKLTRGGTRIIVVSSVEMMEELCDESRFEKAPPMALSKKDDRPSGMF
TATNDDPDWGQAHRILVPAFGPLAIEQMYDHKMHPFVDAMVGFLSESGDRIRRPAIVTSL
MRKKNAKFQRDLDYMFEVSQGLVQHRKQNPTEKKDLLNAMLSGKDPKNKDEMRDDLIIAN
MITFLIAGHETTSGLLSFAFLNLMKNPDAYNAAQREVDQVVGRGPIRVEHLNKFEYLNGV
LRESLRLTPTAPIVSKQLVKGVSGENATLSRGKYKIEQTDKIIALLGAIQQDPNVYGSDA
NEFKPERMMGDDFKNLPSAAWKPFGSGVRACIGRAFAWQEALMVTAMLIQNFDFHLHDPG
YKLRIKQTLTIKPKDLIMQATLRHGMTAMDLEHLLRGSPSSSIKSPEISTAPSKLPDVSS
LKLDSKPMTILYGSNTGTCLAFAQRMASTAAGHGFEAKVSEMDSVVGKLPKSQPIVIITA
SYEGNPPENAARFVSWLGKLEPTSLSGTQFAVFGCGHSDWRATFQKIPTVVDNRMAEFGS
LRLVHRGLSDAANGDLSGDFDDWLNKTFWPKISRGSKSQGAALETGMHLEISTQPGVTSL
RQDVQDGVVVEAKVLTAPGTPEKRHLEIELPPDASYESGDYLAVLPVNSNQNVRRVMKVF
GLAWDSTIVIKGQSLGTLPLDTPLSIRDILAGYVELFEPVSRKILQTMANSATDQDSKQQ
LAAMSRDSETYEKQVLTKRLSIIGLLEAHSSVKLTFRDFLSSLSPLRVRYYSISSSPLHS
PNTCTITYKVLSIPSFSGPGHYAGICGTYLSSLLPGDPIKVSVRPSSKKLFHLPLDIKRT
PLLMFCAGTGIAPFRGFIQQRAMQAAASPDRKLAPAILFVGCRSSTSDRLYAQEFDKWED
LGVVDIRYSFSRDSDSSRSERETVRIGQGYKYVQERMLADIDKKDILRLWDEGARVYVCG
GGAFVKEVGRAAREIVKERLREKGEKIEGREEELEERFKTGLVDRCATDIFG
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgccactcgcactggatgcccaaagaggtaatctccacgtcgatacattcattgcgacg
acctgtccgcgaacagttgtttgtggtgatttatgcaagatgacaacagcaattcctggg
ccaaaagccaaaccccttgtgggaaatttgttggatcttaaagatgaagaagctccactt
agagcactcgaacatttggccgtcgaatatggtcctatatacaaattgaccagagggggc
actagaataatcgtcgttagttctgtggagatgatggaagaactttgcgatgagagtcga
ttcgaaaaggcaccaccaatggcactttcaaaaaaagatgatcgaccgtctggtatgttt
acagcaacgaatgatgatccggattggggtcaagcacatagaattctcgtacccgctttt
ggaccattagctattgagcagatgtacgatcataagatgcatccatttgttgatgcaatg
gtgggatttctatccgaatctggagatagaattaggcgaccagcaatcgttaccagtttg
atgagaaagaagaacgccaaattccaaagagatctagattatatgtttgaggtttctcaa
ggcttagtacaacatcgaaaacaaaaccctacagaaaaaaaggatcttctgaatgcgatg
cttagtggaaaagaccccaagaataaagatgaaatgagggatgatttaatcatagctaac
atgattacatttttgattgctggtcacgaaactacatccgggttgctctcatttgctttc
cttaatttaatgaaaaatccagatgcatacaatgcagctcagcgcgaagtagatcaagtg
gtcggtagaggacctatacgtgtggagcatctcaacaagttcgaatatttaaatggtgta
ctcagagaatcgctacgactcacgccaactgctccaattgtgtcaaaacagctggtcaag
ggtgttagtggagaaaacgcgactctctcccgtgggaaatataagattgaacaaactgac
aaaatcattgcgctacttggggctatacagcaggatcctaacgtttatggatctgatgca
aatgaattcaaaccagagcgtatgatgggagatgatttcaagaacctcccaagtgcggct
tggaaaccatttggaagtggagttagagcatgtattggacgtgcatttgcatggcaagaa
gcattgatggttacagctatgcttatacagaactttgattttcatctccatgatccggga
tataaattacgtatcaagcaaacactcactatcaaaccaaaagatcttataatgcaagct
acactacgtcatggtatgacagctatggatcttgaacatttattgagaggatcaccatcg
tcaagtattaagtcacccgaaatttccacggcaccttcaaaactgcccgatgtctcaagc
ctaaagttggattccaagcccatgacaatactttatggatcaaatacaggaacttgtctt
gctttcgcacaaagaatggcttctaccgctgctggacatggttttgaagccaaagtttcg
gaaatggatagtgtagttggaaaattacctaaatctcaacctatcgttattattacagct
tcgtatgagggtaatccaccagaaaatgcagccagatttgtcagttggttagggaaactc
gaaccaacttcactttcaggaacacaatttgctgtttttggctgcggtcatagtgattgg
agagcgacatttcaaaaaataccaacggtagtagataatcgtatggcggagttcggaagt
ttaagacttgtacacagaggtctttctgatgcagccaatggagatctatctggcgatttc
gatgactggctgaataaaactttttggccaaaaatcagccggggttcgaaatctcaaggg
gcagctctagagacaggaatgcatcttgagatttccactcaaccaggcgttacgagtctc
cgacaagatgtccaagatggtgttgtagttgaagctaaagtattgacagcaccaggaacg
cctgagaaacgtcatctggaaattgaacttcctcccgatgcgtcatatgaaagtggtgat
tatcttgctgtccttccggtaaattcgaatcagaatgttagaagagttatgaaagtgttt
gggctagcttgggattcgaccattgttatcaaaggtcagagtttgggcactttaccactt
gatactccgctatcgattagagatatattggcggggtatgtagagctatttgaacccgtt
agtagaaagatactgcaaacaatggccaattctgcaactgaccaagactcgaaacaacaa
ctcgcagcaatgtctagagattcagaaacctacgaaaagcaagttctgactaaacgacta
agtattattggcttgttagaagcacactcatcagtcaaactcactttccgcgatttcttg
tcttctctttctcccttgcgagtccgctactactcaatctcctcatctcctcttcattct
ccaaatacatgcacaataacctacaaagttctctccatcccatctttctccggccccggc
cactacgccggcatttgcggaacctatctctcctctctcctccccggagatccgatcaaa
gtctccgtccgacccagcagcaaaaaactctttcatctccccttagacatcaaacgaacc
cctctccttatgttttgtgccggcaccggaattgcccctttcagaggctttatccaacag
cgcgccatgcaagctgccgcatcaccggaccgcaaacttgctcctgcgattctatttgtc
gggtgtagatcttcgacttccgatcgtctatatgctcaggaattcgacaaatgggaagac
ctcggtgtagtcgatatccggtattccttttcacgcgattcggattcttctcggagtgaa
agggagacggtgaggatcggacaggggtataaatatgtgcaagagaggatgttggcggat
atagataagaaagatattttgaggttgtgggatgagggggcgagagtatatgtttgtggt
ggaggagcatttgttaaggaggtagggagagcagcgagggaaattgtgaaggagaggtta
agggagaagggagagaagattgaagggagagaagaggagttggaggaaagatttaaaact
gggttggtggatagatgtgcgactgatatttttggttag

DBGET integrated database retrieval system