KEGG   Botrytis cinerea: BC1G_05326Help
Entry
BC1G_05326        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bfu  Botrytis cinerea
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BC1G_05326
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BC1G_05326
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BC1G_05326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 948 aa AA seqDB search
MKGHGTYRCFMMGFEGTEVTPQIRTLIEDHHLGAILLSTKNMKSARETANLVQELQTIAH
QAGHLVPLIIALDQENGGVNSLFDEDYICQFPSAMGMAATGSLELAYEVANATAKELSAV
GVNMIMGPCLDVLTNARYQPLGVRATGDDPQEVSQYGIAAMNGYKDAGLASCGKHFPSYG
NLDFLGSSLDMPIITETLEQLSLGALVPFRNAIREGMDSIMVGGCAIANAGMNVMHACLS
DQVVDDLLRNDLGFNGVVVSECLEMEALSHDIGVRGGTVMAVEAGCDLVLLCRSYSVQRE
AIAGLKLGLENDMISRERINLSLKRVLRVKSQCTSWAKALNPPGISHLTSLHPGHLALST
KAYDNSITIMRDKGHLLPLSNSYSEDDDDLLLLTPLVKPLPASTATLGHDNAKSTNNESE
KSHKSSIMSGEGVFRELGRALARQRHGRLLHTSYTANGVRPVHENLINRAGTIIIITADA
TRNLYQNGFTKHVAMMCSMLSSAGKKKSLIVVSVSSPYDFAMDKSIGTYVCTFDFTETAM
KALVRALFGDFVPQGTLPGTLRKSRKVQKSRQHWLVESYNRDRDARGLQALIKSIEKTTP
PNQQSALSGATAGSFEMPSVANHNSLEESHYVVRNSSTQALFGFCSTSYLPSTHTGTIST
LFVDPSKRNLSIGHSLHQRALRHLLLKPNITHLQLGSTLPAIYLGIPMSDLTEGARLKRW
FATNGWDVLSPRFLYTLIIRNVSIWTPPEGLLGTIQRLSLQFDLIQGPSNAATQVLDFVQ
THSSPEIHSIYNLAIMDNRCCGIVRAKSPIDGSLVGTIIISRSETMLSRWMPVLSSSPTQ
SNSISHTNSNNSNSKGKEKEGNRNENSTVGGILAPIIPSNNAQRETILQGLVMLSIRQNK
NKGDGKAVVLNWVVGSDRDVLLGMGFDVLEAWEEVVCEVDRWSDMSLG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaagggccatgggacatacagatgctttatgatgggattcgaagggaccgaggttact
cctcagatcaggactcttattgaagatcaccatctaggtgctattttgttgtcgacgaag
aacatgaagtctgcccgcgagacagcaaatttagtacaggaactccaaacgatcgcgcat
caagctggtcatctagtccccttaatcattgctcttgaccaagagaatggtggcgttaat
agcctttttgatgaagattacatctgccaatttccaagtgcaatgggaatggcagcaact
ggatctctagagcttgcatacgaagttgccaatgccacagccaaagagttatcagcggtt
ggggttaatatgataatgggcccttgtcttgatgtcttgacaaatgctcgttatcagcca
ttgggtgttagggctactggggacgatcctcaagaagtttcccagtatggtattgctgct
atgaatggatataaggatgctggactcgcttcctgtgggaaacattttccatcttacgga
aatctagatttcttagggtcatctcttgatatgcccataatcacagagactcttgaacag
ttaagtcttggtgctcttgttccttttcgaaatgctattcgtgaaggaatggattctatt
atggttggtggatgtgcaatagcaaatgctgggatgaatgtcatgcacgcttgtcttagt
gatcaagttgtggatgatctccttcgtaacgatcttggctttaacggtgtagttgtttcc
gaatgtcttgaaatggaggcattgagtcatgatattggagtcagaggtggtactgtcatg
gcagtagaagctgggtgtgatttggtacttctctgccgttcttactccgttcaaagagaa
gccattgcaggattaaaacttggtctggaaaacgacatgatctctagagaacgtatcaat
ctctctctaaagcgagttttgagggtcaaatcacagtgcacatcttgggctaaagcctta
aaccctccaggtatcagtcacctaacatctttgcatcctggccacctcgctttgtctaca
aaagcatacgataactcaataactattatgagagataaaggccatttactcccgctatca
aatagttactccgaagatgacgatgatcttctccttctaacaccattagtgaagccatta
cctgcgtcaactgcaactcttggccatgataatgcaaaatctaccaataatgaatctgag
aaatcacacaagtcatcaatcatgagtggcgaaggtgtatttcgagagttagggagagct
ttagcacgtcaaagacatggacgacttctgcatacttcatataccgcaaatggagttcga
ccagttcatgaaaatttgatcaatagagcaggaaccattatcattataacggcagatgca
actcgaaatttatatcaaaatggatttaccaagcatgtcgctatgatgtgttcaatgctt
agttctgcaggaaagaaaaagtcattgattgtggtttcagtgagctctccatatgacttt
gccatggataagagtattgggacatatgtttgtacttttgattttacggaaacggctatg
aaagcattggtgagagcgttatttggcgattttgttcctcaaggaacattacctggtacg
cttagaaagagtaggaaagtacagaaatcgagacagcattggttagtggagagttataat
agagatagagatgcaagaggtctacaagcactcattaaatctattgagaagactactcca
ccgaatcagcaatcggcattatcgggagcgacagcgggttcgttcgaaatgccatccgtc
gcaaatcataattctcttgaagagtctcattacgttgtgcgcaacagcagtactcaagct
ctatttggcttttgctccaccagttatttacccagtactcataccggtacaatctccacc
ctatttgtcgacccttccaaacgtaatctttctatcggtcactcccttcatcaacgcgct
ctccgccatctccttctaaaaccaaatatcactcaccttcaacttggctctaccctccca
gctatctacctaggcatccctatgagcgacctcaccgaaggcgcacgtcttaaacgctgg
ttcgctacaaatggctgggacgtcctttctccccgatttctgtacacattgataattcgc
aacgtatcaatttggacccctccggaaggcctcttaggaacaatccaacgcctgtccctt
caatttgatttaattcaaggtccttcaaatgccgcaacccaagttctcgacttcgtccag
actcattcgtcgcctgaaattcatagtatttataatctcgcaatcatggataacagatgt
tgtggtattgtgagggctaaatcaccaatcgatgggagtctcgtggggacgattatcatc
tctcgttctgagaccatgctttctcgctggatgcccgttctttcttcttctcctactcaa
tctaattctatttcccatacaaattccaacaactcgaattccaaggggaaagaaaaggaa
ggaaatagaaatgaaaatagcacagtagggggtatcctagccccaatcatcccatcgaat
aatgcacaacgtgaaacaatcttgcaaggattggtcatgttgagtatccgacagaataaa
aataagggggatggaaaggcagtggtgttgaattgggttgtgggaagtgatagggatgtt
ttgctggggatgggatttgatgtgttggaggcgtgggaagaggttgtttgtgaagttgat
aggtggagtgatatgagtctaggttga

DBGET integrated database retrieval system