KEGG   Botryotinia fuckeliana: BC1G_05371Help
Entry
BC1G_05371        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bfu  Botryotinia fuckeliana
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:bfu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 526 aa AA seqDB search
MAGSTLQFSKPMSIKEISAKASDFEFNPTIALKYWLRTADTLLREAYIYQAEDNDQQAYL
LLMRYAALVAEKLPGHPSAKDLETRSALRAAQKNLPDVLDGLERLKPRINSRYNNWQKAL
ERRKEIHAARENDTSRPSSRADLAASDPAIAGNTTTLGAAENSDLAVKLAHKEFRRRDAA
RLATRQAGVTEEEEQERRTAGLWDDWESALSKSGRNDDEDVIRRNMEASRRRLDGSHDIS
PDGTKKKSARPTRYVQTKARNASSAYRYPSISKSQPLVSDSGPFPPPGPLPPKPPKEEFE
TPHFDTPPPRPEKQSSDTHEISSSDVVGQDPKFTFRPSAYLENGKPLRTVFLPPTLRQQF
LACAASNTRANLETCGMLCGTLISNALFISRLVIPEQTSTSDTCETTNESALFDYCASED
LMVLGWIHTHPTQSCFMSSRDLHTHCGYQIMMPESIAIVCAPSKNPSWGVFRLTDPPGMP
AVLNCKQTGLFHPHEERNIYTDALRPGHVFEAEGLEFQVVDQRPNP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcaactttacagttctcgaagcccatgagcatcaaagaaatctccgcaaag
gcctcagactttgaatttaatcctactatcgcattgaaatattggttgagaacagctgat
acacttttaagagaggcatatatttatcaagcagaggacaacgatcagcaagcttacctt
ttgttgatgcgatacgctgccctagttgcagaaaagttgcccggtcacccatccgcaaag
gatctagaaactagaagtgctctcagagctgcccagaaaaatctcccggatgttttggac
ggattagagagattgaagcccaggataaattcgcgctacaataactggcagaaggctttg
gaaagaaggaaagaaatccatgcagcgcgagaaaatgacacatcgcgcccatcgtctcgg
gcagatctggcggcttctgatcccgcgatagctggaaatacaaccacattaggcgccgcg
gagaatagcgacctggccgtaaaattggcgcataaggagtttagaagaagagatgctgcg
agacttgctacaagacaagcaggtgttactgaggaagaggagcaagaaaggcggactgcg
gggctatgggacgattgggaatcggcattgtctaaatctggtcgtaatgatgatgaggat
gtaatacgccgaaatatggaagcttcaaggaggaggctagatggctcccatgatatttcg
ccagatgggacgaagaaaaaatctgcgagacctacacgatatgtccaaactaaggccagg
aatgctagtagcgcataccgctatccatctatctctaagtctcaaccactcgttagtgac
tcgggaccattcccacctcccggtcctcttcccccaaagccgcccaaggaagaattcgag
acaccgcatttcgatacgcccccaccacgacccgaaaaacaatcatcagacactcacgag
atttcctcatcagatgtcgttggtcaagacccaaaattcacttttcgaccttcggcatat
ctcgaaaatggcaaacctcttcgaacagtctttctaccgcctacattgcgacaacaattt
ctggcctgtgcagcctcaaatacacgggctaatcttgaaacttgtgggatgctgtgcgga
acattgatatcgaatgcccttttcatatctcgacttgtcatcccagaacagacgagtacc
agcgatacttgtgaaacgaccaatgaaagtgccttatttgattactgcgcatctgaggat
ctaatggtcttgggatggatacacactcatcctactcaaagctgcttcatgagtagtcga
gatctgcatacacattgtggatatcaaatcatgatgcctgagagtatcgcaatcgtttgc
gctcccagtaaaaatccttcatggggagtcttccgtctgactgaccccccaggaatgccc
gccgttctaaactgtaaacaaacgggacttttccatcctcacgaggaaaggaatatttac
acagatgcattacgaccaggccatgtctttgaggcagaagggctagaattccaagttgtt
gaccaacggccaaacccataa

DBGET integrated database retrieval system