KEGG   Botrytis cinerea: BC1G_05371Help
Entry
BC1G_05371        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bfu  Botrytis cinerea
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    BC1G_05371
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     BC1G_05371
Peptidases [BR:bfu01002]
 Metallo Peptidases
  Family M67
   BC1G_05371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 526 aa AA seqDB search
MAGSTLQFSKPMSIKEISAKASDFEFNPTIALKYWLRTADTLLREAYIYQAEDNDQQAYL
LLMRYAALVAEKLPGHPSAKDLETRSALRAAQKNLPDVLDGLERLKPRINSRYNNWQKAL
ERRKEIHAARENDTSRPSSRADLAASDPAIAGNTTTLGAAENSDLAVKLAHKEFRRRDAA
RLATRQAGVTEEEEQERRTAGLWDDWESALSKSGRNDDEDVIRRNMEASRRRLDGSHDIS
PDGTKKKSARPTRYVQTKARNASSAYRYPSISKSQPLVSDSGPFPPPGPLPPKPPKEEFE
TPHFDTPPPRPEKQSSDTHEISSSDVVGQDPKFTFRPSAYLENGKPLRTVFLPPTLRQQF
LACAASNTRANLETCGMLCGTLISNALFISRLVIPEQTSTSDTCETTNESALFDYCASED
LMVLGWIHTHPTQSCFMSSRDLHTHCGYQIMMPESIAIVCAPSKNPSWGVFRLTDPPGMP
AVLNCKQTGLFHPHEERNIYTDALRPGHVFEAEGLEFQVVDQRPNP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcaactttacagttctcgaagcccatgagcatcaaagaaatctccgcaaag
gcctcagactttgaatttaatcctactatcgcattgaaatattggttgagaacagctgat
acacttttaagagaggcatatatttatcaagcagaggacaacgatcagcaagcttacctt
ttgttgatgcgatacgctgccctagttgcagaaaagttgcccggtcacccatccgcaaag
gatctagaaactagaagtgctctcagagctgcccagaaaaatctcccggatgttttggac
ggattagagagattgaagcccaggataaattcgcgctacaataactggcagaaggctttg
gaaagaaggaaagaaatccatgcagcgcgagaaaatgacacatcgcgcccatcgtctcgg
gcagatctggcggcttctgatcccgcgatagctggaaatacaaccacattaggcgccgcg
gagaatagcgacctggccgtaaaattggcgcataaggagtttagaagaagagatgctgcg
agacttgctacaagacaagcaggtgttactgaggaagaggagcaagaaaggcggactgcg
gggctatgggacgattgggaatcggcattgtctaaatctggtcgtaatgatgatgaggat
gtaatacgccgaaatatggaagcttcaaggaggaggctagatggctcccatgatatttcg
ccagatgggacgaagaaaaaatctgcgagacctacacgatatgtccaaactaaggccagg
aatgctagtagcgcataccgctatccatctatctctaagtctcaaccactcgttagtgac
tcgggaccattcccacctcccggtcctcttcccccaaagccgcccaaggaagaattcgag
acaccgcatttcgatacgcccccaccacgacccgaaaaacaatcatcagacactcacgag
atttcctcatcagatgtcgttggtcaagacccaaaattcacttttcgaccttcggcatat
ctcgaaaatggcaaacctcttcgaacagtctttctaccgcctacattgcgacaacaattt
ctggcctgtgcagcctcaaatacacgggctaatcttgaaacttgtgggatgctgtgcgga
acattgatatcgaatgcccttttcatatctcgacttgtcatcccagaacagacgagtacc
agcgatacttgtgaaacgaccaatgaaagtgccttatttgattactgcgcatctgaggat
ctaatggtcttgggatggatacacactcatcctactcaaagctgcttcatgagtagtcga
gatctgcatacacattgtggatatcaaatcatgatgcctgagagtatcgcaatcgtttgc
gctcccagtaaaaatccttcatggggagtcttccgtctgactgaccccccaggaatgccc
gccgttctaaactgtaaacaaacgggacttttccatcctcacgaggaaaggaatatttac
acagatgcattacgaccaggccatgtctttgaggcagaagggctagaattccaagttgtt
gaccaacggccaaacccataa

DBGET integrated database retrieval system