KEGG   Botrytis cinerea: BC1G_05953Help
Entry
BC1G_05953        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bfu  Botrytis cinerea
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BC1G_05953
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     BC1G_05953
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     BC1G_05953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 381 aa AA seqDB search
MPEIAEVARAVHYIRKSLVGKTLAVVKAQDDANVFGKVGTSAAEFQKALTGKKVEGAGQQ
GKYFWSKNEDEEEVWPPRFSKFSLQTAGEPKVEAAFTDSRRFSRIRLVNCIAEAIRDTSP
LKENGPDPVLDKDILTAEWLEQKLNKKQVPIKALLLDQANISGIGNWVGDEILYNARLHP
EQYSNTFTSEEIKRLHTSMMYICQTAVDLLADSSKFPDNWMFKHRWGKGKKDGPAALPNG
EKITFLTVGGRTSCVVPSVQKKTGAVAGDMKKRSTSSDSGDVKDVPVNKQSLRKRKAAVA
TKSEETDEDITERKKVKARSRKPIQVKEEILDDDAGDISIKAGKLTKEKTSKSTESKATE
DIAAIRPTRRSSRQTKPVVPL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaatcgcggaggttgcgcgagctgtgcactacatacgaaaaagtcttgttggc
aaaacattggcggttgttaaggcccaggatgatgccaatgtctttggaaaggtcggaaca
agtgctgccgaattccaaaaggcattgactggtaagaaggttgaaggtgctggacagcaa
ggaaaatacttctggtcgaaaaatgaggacgaagaggaagtctggccaccgaggttctcg
aaattctcactacaaacagctggagaaccaaaggttgaggctgcgttcacagattcacgt
agattctcaaggattcgactagtaaattgcatcgctgaagccattcgagacacgtctcca
cttaaagagaacggcccagatcctgttcttgataaagacatcttgacagctgagtggctc
gaacaaaaactgaacaagaagcaggtgcctataaaggcattattgcttgaccaagcgaac
atcagtggaattggaaattgggttggcgatgaaatactctacaatgcacgacttcatccc
gagcaatatagtaacacgttcacctccgaagagatcaagcgattgcatacttcgatgatg
tacatttgtcaaacagcagtagacttgttggcagattcatccaaatttcctgataactgg
atgttcaagcatcgatgggggaaggggaagaaagacggcccggcagcattaccgaacggg
gagaaaatcacctttcttaccgttgggggaagaacttcttgtgtggtgccaagtgtacag
aagaaaacgggtgccgttgctggtgatatgaagaagagaagtacgtcgagtgatagtggg
gatgttaaggatgttccagtgaacaagcaaagcttgaggaagaggaaggctgccgtggct
acgaaatcagaagaaactgatgaagatatcacagaacgcaagaaggtgaaagcgagatct
cgaaaacccattcaggtcaaagaagagattctagatgatgatgcgggggacatttccata
aaagcaggcaagctgactaaggagaagacgtcaaaatctaccgaatcaaaagccacagaa
gatattgcagcaattcgaccgacacgcagatccagccgtcagacaaagcctgttgtaccc
ctttga

DBGET integrated database retrieval system