KEGG   Botryotinia fuckeliana: BC1G_05953Help
Entry
BC1G_05953        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bfu  Botryotinia fuckeliana
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bfu03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 381 aa AA seqDB search
MPEIAEVARAVHYIRKSLVGKTLAVVKAQDDANVFGKVGTSAAEFQKALTGKKVEGAGQQ
GKYFWSKNEDEEEVWPPRFSKFSLQTAGEPKVEAAFTDSRRFSRIRLVNCIAEAIRDTSP
LKENGPDPVLDKDILTAEWLEQKLNKKQVPIKALLLDQANISGIGNWVGDEILYNARLHP
EQYSNTFTSEEIKRLHTSMMYICQTAVDLLADSSKFPDNWMFKHRWGKGKKDGPAALPNG
EKITFLTVGGRTSCVVPSVQKKTGAVAGDMKKRSTSSDSGDVKDVPVNKQSLRKRKAAVA
TKSEETDEDITERKKVKARSRKPIQVKEEILDDDAGDISIKAGKLTKEKTSKSTESKATE
DIAAIRPTRRSSRQTKPVVPL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaatcgcggaggttgcgcgagctgtgcactacatacgaaaaagtcttgttggc
aaaacattggcggttgttaaggcccaggatgatgccaatgtctttggaaaggtcggaaca
agtgctgccgaattccaaaaggcattgactggtaagaaggttgaaggtgctggacagcaa
ggaaaatacttctggtcgaaaaatgaggacgaagaggaagtctggccaccgaggttctcg
aaattctcactacaaacagctggagaaccaaaggttgaggctgcgttcacagattcacgt
agattctcaaggattcgactagtaaattgcatcgctgaagccattcgagacacgtctcca
cttaaagagaacggcccagatcctgttcttgataaagacatcttgacagctgagtggctc
gaacaaaaactgaacaagaagcaggtgcctataaaggcattattgcttgaccaagcgaac
atcagtggaattggaaattgggttggcgatgaaatactctacaatgcacgacttcatccc
gagcaatatagtaacacgttcacctccgaagagatcaagcgattgcatacttcgatgatg
tacatttgtcaaacagcagtagacttgttggcagattcatccaaatttcctgataactgg
atgttcaagcatcgatgggggaaggggaagaaagacggcccggcagcattaccgaacggg
gagaaaatcacctttcttaccgttgggggaagaacttcttgtgtggtgccaagtgtacag
aagaaaacgggtgccgttgctggtgatatgaagaagagaagtacgtcgagtgatagtggg
gatgttaaggatgttccagtgaacaagcaaagcttgaggaagaggaaggctgccgtggct
acgaaatcagaagaaactgatgaagatatcacagaacgcaagaaggtgaaagcgagatct
cgaaaacccattcaggtcaaagaagagattctagatgatgatgcgggggacatttccata
aaagcaggcaagctgactaaggagaagacgtcaaaatctaccgaatcaaaagccacagaa
gatattgcagcaattcgaccgacacgcagatccagccgtcagacaaagcctgttgtaccc
ctttga

DBGET integrated database retrieval system