KEGG   Botryotinia fuckeliana: BC1G_05988Help
Entry
BC1G_05988        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
bfu  Botryotinia fuckeliana
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bfu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bfu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bfu03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bfu03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bfu03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bfu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bfu03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 202 aa AA seqDB search
MPTTRRSSGPAQKGTQKTLSFTNTSKISKAASTPSTLKTQSSLIKLPSPKDLTKPSPASP
ELKPTALATTSPKSSSQPQSKPKPQTAHQTLQTSLASQITDAKIRKYWKAREDLRLAPRV
HQQDLEISEKILREWDCMSQFGPAIGIPRTKRWHRASKLGLNPPLEVLAVLLKEEEKKNK
TVERAYVDELMGAKGIIGGDVV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccacccgtcgcagcagcggccccgcccaaaaaggcactcaaaaaaccctctcc
ttcaccaacacctccaagatctccaaagcggccagcacccccagcacactcaaaacccaa
tcatccctcatcaaactcccaagccctaaagacctcaccaaaccctcccccgcatctcca
gaactcaaacccaccgccctcgcaaccacatctcccaaatcatcctcccagccccaatcc
aaacccaaaccccaaaccgcccatcaaaccctccaaacctccctcgcatcgcaaatcacc
gatgccaaaatccgcaaatactggaaagcgcgcgaggatctgcgtttagcgcctcgagta
caccaacaggatttagaaatcagcgagaagatattgagggaatgggattgtatgagccaa
tttggtcccgcaatcggcatcccccgcaccaaacgctggcaccgcgcctcaaaactcggt
ttaaatccacccctcgaagtcctcgccgttctcctcaaagaagaagaaaagaaaaacaag
accgtagaaagagcgtatgtggatgaattgatgggggcgaaaggaattattggaggagat
gtggtataa

DBGET integrated database retrieval system