KEGG   Botrytis cinerea: BC1G_05988Help
Entry
BC1G_05988        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
bfu  Botrytis cinerea
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC1G_05988
   00240 Pyrimidine metabolism
    BC1G_05988
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BC1G_05988
   03410 Base excision repair
    BC1G_05988
   03420 Nucleotide excision repair
    BC1G_05988
   03430 Mismatch repair
    BC1G_05988
   03440 Homologous recombination
    BC1G_05988
DNA repair and recombination proteins [BR:bfu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      BC1G_05988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 202 aa AA seqDB search
MPTTRRSSGPAQKGTQKTLSFTNTSKISKAASTPSTLKTQSSLIKLPSPKDLTKPSPASP
ELKPTALATTSPKSSSQPQSKPKPQTAHQTLQTSLASQITDAKIRKYWKAREDLRLAPRV
HQQDLEISEKILREWDCMSQFGPAIGIPRTKRWHRASKLGLNPPLEVLAVLLKEEEKKNK
TVERAYVDELMGAKGIIGGDVV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccacccgtcgcagcagcggccccgcccaaaaaggcactcaaaaaaccctctcc
ttcaccaacacctccaagatctccaaagcggccagcacccccagcacactcaaaacccaa
tcatccctcatcaaactcccaagccctaaagacctcaccaaaccctcccccgcatctcca
gaactcaaacccaccgccctcgcaaccacatctcccaaatcatcctcccagccccaatcc
aaacccaaaccccaaaccgcccatcaaaccctccaaacctccctcgcatcgcaaatcacc
gatgccaaaatccgcaaatactggaaagcgcgcgaggatctgcgtttagcgcctcgagta
caccaacaggatttagaaatcagcgagaagatattgagggaatgggattgtatgagccaa
tttggtcccgcaatcggcatcccccgcaccaaacgctggcaccgcgcctcaaaactcggt
ttaaatccacccctcgaagtcctcgccgttctcctcaaagaagaagaaaagaaaaacaag
accgtagaaagagcgtatgtggatgaattgatgggggcgaaaggaattattggaggagat
gtggtataa

DBGET integrated database retrieval system