KEGG   Botrytis cinerea: BC1G_06074Help
Entry
BC1G_06074        CDS       T01072                                 

Definition
calcineurin regulatory subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bfu  Botrytis cinerea
Brite
Protein phosphatases and associated proteins [BR:bfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     BC1G_06074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 174 aa AA seqDB search
MGNTSSAVLENIVQGSNFDRDEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDRDGKISFEEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacaagtagtgcagtattggagaatattgtacaagggtcaaactttgatcga
gatgaggttgatagattaagaaaacgttttatgaagttggataaggacaattccggtact
attgaacgtgaagagttcctcagtcttccgcaaatatcgtcgaatcctctagctaccaga
atgattgccatattcgatgaagatggaggtggagatgttgatttccaagagttcgtcagt
ggactcagcgcattcagcagtaagggaaataaggaacaaaagcttcgttttgcattcaag
gtttatgacatcgatcgtgatggatacataagcaatggagaattattcatcgttttgaag
atgatggtaggaagtaatttgaaggatcaacagttgcaacagattgttgataaaacaatt
atggaggcagatttggatagggatggaaagattagtttcgaggaatttacaaagatggtg
gagaatacggatgtttctatgagtatgactttagatcaattttga

DBGET integrated database retrieval system