KEGG   Botryotinia fuckeliana: BC1G_06199Help
Entry
BC1G_06199        CDS       T01072                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bfu  Botryotinia fuckeliana
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bfu00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:bfu00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 302 aa AA seqDB search
MASIASARYGKDNVRVYKVDRDEQTGTQTVTEMTVCVLLEGAIDVSYTKADNSVVVATDS
MKNTVYIKAKEHSVTPPELFASILGTHFIETYPHLTAASIKIVTHRWTRMTIDGKPHPHS
FYRDGSETRNVDAVIKRGKGIDIRSGIVGLLVLKSTGSQFHGFVRDEYTTLPEVWDRILS
TDVDCGWSWKTFAGLDAVKEAIPKFDKAFDDARNITMKTFAEENSPSVQNTMYKMCGSIL
EAVPEVETVDYSLPNKHYFEVDLSWHKGLKNTGKDAEVYAPQSGPNGLINVTVTRTPVTP
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgatagcttccgcaagatatggcaaggacaacgtccgcgtctataaagtagac
agagatgagcagactggaactcaaactgtcaccgaaatgaccgtttgtgtattactggag
ggtgcaatcgacgtctcatataccaaggccgacaacagtgttgtggttgcaaccgattcc
atgaagaacacagtctacatcaaagccaaggaacattcagttactcctcccgagctcttt
gctagtattctcggaactcactttatcgagacctacccccatctcaccgcagccagcatc
aaaatcgttactcacagatggacacgaatgactatcgatggcaaaccccacccacattca
ttctacagagacggaagcgagacacgaaatgtcgatgctgttatcaagagaggaaagggc
atcgatatccgtagcggaattgttggactcttggttttgaagagcacaggttcgcaattc
cacggctttgtccgagacgagtacactacgctccccgaggtttgggacagaattttgtca
actgatgttgattgcggctggtcatggaaaacatttgccggattggacgccgtgaaagag
gccatccccaaatttgacaaagcatttgatgatgccagaaatatcaccatgaagacattc
gctgaagagaacagcccatctgtacaaaacaccatgtataagatgtgcggttccattttg
gaggccgtcccagaagtcgagactgtggattactccttgcccaataagcattatttcgaa
gttgatctcagctggcacaagggtcttaagaacaccggaaaggacgcagaagtttatgct
cctcaatctggaccaaacggactcatcaatgtcaccgtcaccagaactccagtcacacca
aagctatag

DBGET integrated database retrieval system