KEGG   Botrytis cinerea: BC1G_06199Help
Entry
BC1G_06199        CDS       T01072                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bfu  Botrytis cinerea
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC1G_06199
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BC1G_06199
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     BC1G_06199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 302 aa AA seqDB search
MASIASARYGKDNVRVYKVDRDEQTGTQTVTEMTVCVLLEGAIDVSYTKADNSVVVATDS
MKNTVYIKAKEHSVTPPELFASILGTHFIETYPHLTAASIKIVTHRWTRMTIDGKPHPHS
FYRDGSETRNVDAVIKRGKGIDIRSGIVGLLVLKSTGSQFHGFVRDEYTTLPEVWDRILS
TDVDCGWSWKTFAGLDAVKEAIPKFDKAFDDARNITMKTFAEENSPSVQNTMYKMCGSIL
EAVPEVETVDYSLPNKHYFEVDLSWHKGLKNTGKDAEVYAPQSGPNGLINVTVTRTPVTP
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgatagcttccgcaagatatggcaaggacaacgtccgcgtctataaagtagac
agagatgagcagactggaactcaaactgtcaccgaaatgaccgtttgtgtattactggag
ggtgcaatcgacgtctcatataccaaggccgacaacagtgttgtggttgcaaccgattcc
atgaagaacacagtctacatcaaagccaaggaacattcagttactcctcccgagctcttt
gctagtattctcggaactcactttatcgagacctacccccatctcaccgcagccagcatc
aaaatcgttactcacagatggacacgaatgactatcgatggcaaaccccacccacattca
ttctacagagacggaagcgagacacgaaatgtcgatgctgttatcaagagaggaaagggc
atcgatatccgtagcggaattgttggactcttggttttgaagagcacaggttcgcaattc
cacggctttgtccgagacgagtacactacgctccccgaggtttgggacagaattttgtca
actgatgttgattgcggctggtcatggaaaacatttgccggattggacgccgtgaaagag
gccatccccaaatttgacaaagcatttgatgatgccagaaatatcaccatgaagacattc
gctgaagagaacagcccatctgtacaaaacaccatgtataagatgtgcggttccattttg
gaggccgtcccagaagtcgagactgtggattactccttgcccaataagcattatttcgaa
gttgatctcagctggcacaagggtcttaagaacaccggaaaggacgcagaagtttatgct
cctcaatctggaccaaacggactcatcaatgtcaccgtcaccagaactccagtcacacca
aagctatag

DBGET integrated database retrieval system