KEGG   Botrytis cinerea: BC1G_06306Help
Entry
BC1G_06306        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bfu  Botrytis cinerea
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    BC1G_06306
Enzymes [BR:bfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     BC1G_06306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 556 aa AA seqDB search
MSRASGASFAQFFPSAPRAAKDKAKEREKSKAQQADSPTTLSATDTQINAKALTDNASIT
RLSEDISIPLADPPTLTTEDNESVQGDILNGVGSASSHSSSGSSLFSVNNQLSNSMQASA
GSRNINDSTPLTNADLSPNGVASPGNAKADMPFTATTRAALDNIKSEHVVAISNSATAEH
TSTEPRVLARDPARGVKGKKCTYDPFHDPHIHSTKEKHNRRPHYKEFGLKDDAPPADPRL
AKGSRLSYINTDYHNALSRLNHSPFMLPKYKYNPKTHYGPGPPTEIVVTGYDPLINFMKV
TNVFTHYGQIAESSNKLHPETGSCLGFGTFRYRDTKKKDGTTLTAAEAAKKAVMRGSSVV
GLGPRIKVQFDPQGKRSTRMLENALEKSKPEPLPLPPKEPPPPPKSEVAKSSGPPPSAPK
GPAALSGRPQFRTGIVQAAIPTKPRQQTLIEDEPIAQQLEDEPYIFISKDYVPVIPATIL
HLKKRLKNHFLEDVRVDRTGYYVVFALSDEGRFEADRCYNSCNGTALFSYEMIMKLESGQ
KASILHAKLLKSSNES
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcgcatctggggcgagtttcgcacaattctttccttcggctcctcgagctgcg
aaagacaaagcaaaggagagggaaaagtcaaaggcgcagcaggcagattcgcctaccacc
ctttctgccactgatacccaaattaatgcgaaagccttaactgacaatgcttctattaca
cgtctttcagaagatatatcaattccacttgcggatcctcccaccctgacgacagaagat
aacgaatctgtacaaggcgatattttgaatggtgtaggctcagcaagctcacattcaagc
tctggatcatcccttttcagtgtcaacaatcagctttccaacagcatgcaagcatctgct
ggctctcgaaatatcaacgattcaacaccattgacaaatgccgacttatcacccaatggt
gttgcgagtcctggcaatgccaaggctgatatgcctttcaccgctacaacccgcgccgct
cttgataatataaaatctgagcatgtcgttgctatatccaattctgccacggcagagcat
acttccaccgagccacgagtcctcgctcgagacccagcacgaggtgtaaaggggaaaaaa
tgcacatatgatcctttccacgacccccacatccattcgacgaaagaaaaacataatcgc
cgcccacattataaggagtttggtttgaaagatgacgctcccccagcggatccgaggttg
gcgaaaggaagcagattgtcgtatatcaataccgactaccataatgcattatcgcgactc
aaccattcgccgttcatgctaccaaagtataaatacaaccctaaaactcattatggacct
ggcccaccaacggaaattgttgtcactggatatgatccattaataaattttatgaaggtc
actaatgttttcactcattatggacaaatcgcagagagcagtaataaactacatccagag
acaggaagttgtttgggctttggcacattccgatatcgagatactaaaaagaaggatggc
acaaccctgacagcggcagaggctgccaagaaagccgtcatgagaggcagcagtgtggta
gggctgggaccaagaatcaaggtccaattcgatccgcaaggaaagcgcagtactcgcatg
ctcgagaatgctttggaaaagtcgaaacccgaacctttacctctcccgcccaaggaacca
ccacctccccctaaatctgaagttgccaaatcatctggacccccaccaagtgcccccaaa
gggcctgccgctctttctggcagaccgcagtttagaacaggcatagtacaagctgcgatt
cctacgaaaccacgccagcagacattaatcgaggatgaaccaatcgcgcaacaacttgag
gatgagccctacatttttatctcgaaagattatgttcctgttattcccgcgacgatcctc
catttgaaaaagcggctcaagaaccatttcttggaggatgttagagttgatagaacaggt
tattatgtcgtcttcgcgctcagtgacgagggaagattcgaggcagacaggtgttacaat
tcttgcaatggcactgcgctgttttcatatgaaatgattatgaagctcgagagcgggcaa
aaagcttcgatcctgcacgcgaagctattgaagtcatcaaacgagagttaa

DBGET integrated database retrieval system