KEGG   Botrytis cinerea: BC1G_06474Help
Entry
BC1G_06474        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfu  Botrytis cinerea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1G_06474
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1G_06474
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BC1G_06474
Enzymes [BR:bfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BC1G_06474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 885 aa AA seqDB search
MTDHTPSQRYLSTRGGDYGLSFEEVVLKGLAADGGLFIPEQIPSVPENWESKWKDLSFSD
LAFEILSLYISPSEIPAADLKDIINRSYSTFRDPKTTPLVPLSEKDNLYLLELFHGPTFA
FKDVALQLLGNLFEYFLVRRNKGKEGKDRHHLTVVGATSGDTGSAAIYGLRGKKDVSVFI
LHPKGRVSPVQEAQMTTVLDANVHNLAVEGTFDDCQDTVKALFADPQINETMNLGAVNSI
NWARILAQTTYYFHAYFSLQKSSGYKPENKVRFVVPTGNFGDILAGYFAKRMGLPAEKLV
IATNENDILYRFWKTGHYEKKAVHGVEAEGGLAEDGVKAHEDGVKETLSPAMDILVSSNF
ERLLWFLAYEYASGAGMDDEWNKKQAGQEVEVWLKQLKTNGGFNVQDEILKAANRDFESE
RVSDKQTIDTIKDFYTSGSYVLDPHSAIGVAASLRSISRSPDAYHISLSTAHPAKFANAV
DLALKDEKSFSFDTVLPKEFHCLPLMIGLLAGLCEACLFSMLSAAPHFKSTFIAARSPAP
KRNTICLSFIDLRKSSKLILYIMADPVGFTASVIGIATLAVQLGDALRKAAEFWEAVQDA
PSDIRRLSKELRLVASVFHTIRVEYEAGSTPINFESMVKGALELAKDDIDQLSEFISKLS
RNLSVANGSLGRQWKKVQMALKASKIERFRDNLESVKTTMALLQGSRQQVSMIQVNSKLD
SNFVPSSSWRGSRGSVSKSVNQHKTNFLLGTFNFRTTSTTYWYNDDDGKDGANNSTTTKT
FLIEFLMGFTTCRKGLRFMTTSTFDRYALDVVRRRPNDSEIFKLCRDGSVQAVRRFLDRG
EASIHDVNEIGGSLLHIAVINDNEQLCAMLLDLGADVYWEDDHGL
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccataccccttcacaaagatacctgtcgaccagaggtggcgattatggatta
tcattcgaagaagtcgtgctgaaaggtctcgcggctgatggaggattattcattcctgaa
caaattccatcagtacctgagaactgggagtcaaaatggaaggacttgtcattctctgac
cttgcattcgaaatcctttccctctacatctctccttccgaaatcccagctgcagacttg
aaggacatcataaatcgaagttactctacatttcgcgacccgaagactacacctcttgtt
cctctcagcgaaaaagataatctataccttttggaattattccacggtcctacatttgca
ttcaaagatgtcgcactacaattacttggaaatctttttgaatacttcctcgtcagacgt
aataagggcaaggagggaaaagacagacaccatcttacagttgttggggctacaagtggt
gatactggatctgcagctatctacggtcttcgaggcaagaaggatgtctcagtattcatt
ttacatccaaagggtagagtaagccctgtgcaagaggctcaaatgacgacagttttggat
gccaatgtgcacaacttggcggttgaaggcacttttgatgattgccaggataccgtcaaa
gccttgttcgcggacccacagatcaacgagacaatgaaccttggagctgtcaattccatc
aattgggcgagaattttggcacaaaccacatattacttccatgcatacttctctcttcag
aagtcgtctggatataaacccgaaaacaaagtccgctttgtggtccctactggtaacttc
ggtgatattctggctggatacttcgcgaagcgcatgggtctaccagctgaaaagcttgtg
attgcgacaaacgagaacgatatcttgtaccgcttctggaagacaggacactacgagaag
aaagcggttcatggcgtcgaagctgaaggtggacttgccgaagatggtgttaaggcacat
gaagatggtgtcaaggagactcttagcccagctatggacattcttgtctcaagcaatttt
gagcgattgctgtggtttttggcctacgagtatgcctctggcgctggtatggatgatgaa
tggaataaaaagcaagccggtcaggaagttgaagtctggcttaaacaattgaaaacaaac
ggtggattcaatgtccaagacgaaatcctcaaggctgccaatagagatttcgagagcgaa
agagtcagcgacaagcaaaccattgacacaattaaggatttctataccagcggttcctat
gttttggatccacattcagccatcggtgtagctgcttcattacgatccatctcccgctca
ccagatgcatatcacatttctctctcaacagcacacccagccaaatttgcaaatgctgtt
gatcttgcattgaaggatgaaaagagcttcagtttcgacacagtactccccaaagaattt
cattgcctccctctaatgattggtttgctcgctgggttgtgtgaggcttgtctcttttcg
atgctgagcgcagcaccccacttcaaatctacatttattgcggcccggtcccctgcgccc
aaacgaaataccatctgtttatctttcattgatctcagaaagtcttccaaattgatattg
tacatcatggcggatcctgttggctttacagcaagcgtcattggtattgcgacacttgcg
gtgcaacttggggatgccctgagaaaagcagctgaattttgggaagctgttcaggatgct
ccttcagacattcgccgcttatctaaagagcttcgacttgtggctagcgtctttcataca
attcgagttgaatatgaagctggtagcacacctataaatttcgaaagcatggtcaagggc
gctcttgaattagcaaaagacgatattgatcaactctcagagtttatctcaaagttgtcg
cgaaatctatccgttgccaatgggagtctcggtaggcaatggaaaaaggttcaaatggcc
ttgaaagcaagcaagatagaaaggttcagggataatcttgagagcgtgaagaccactatg
gccttactacaggggagcaggcaacaggtttctatgatccaagtcaatagcaagctcgat
agcaactttgtgccttccagtagttggagaggttctcgcggtagtgtttctaaatcggtt
aatcaacacaaaacgaatttcttactgggtactttcaattttcgaaccacttctaccaca
tactggtataacgacgacgatggcaaagatggtgccaacaattcgacaactaccaagact
ttcctgatcgagtttctaatgggatttacgacatgtcgcaaaggtttgcgattcatgacg
acaagcacttttgatcgttatgcacttgatgttgttcggcgccgaccaaatgattcagaa
atttttaaactttgtagagatggtagtgttcaagctgttaggaggtttctggatcgtggc
gaagcatctattcatgatgtgaatgagataggagggtctcttttacatatagctgtcatc
aatgacaacgaacagctttgcgcaatgcttcttgatctaggagcagacgtatactgggag
gatgatcatggcctgtaa

DBGET integrated database retrieval system