KEGG   Botryotinia fuckeliana: BC1G_06723Help
Entry
BC1G_06723        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bfu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 797 aa AA seqDB search
MRFLSVSLLSTVFASVVLAQTGEQSIENPSPDLPGEEEAADVPQPTTFNGVQVPPLPDID
GELFNQTVAEGYWFVKHHSPYCPHCIHIAPTWQTLYEFYYTSKPVKSGAEDTASTSLNTF
SAYYNYHFGSLDCIAFGTACTDHGVTSFPTFILYKDGEEAKRFVGPKDMEKLGAFIEGNL
ESIRPGSRPIGGPKYPEERATQSPDYQPEAAASKETEKTTEKSTEKASDKSSEKASEKST
EKESDKTSEKSSEKSTEKSSGGSTQKSETGAEKVTDKVADAAAPVKDAVKDTAENVKDSV
KDAVKETKPEVAKITTKPILKATPIENKPSKPTQTANPLGTSVSLTAESFQNLVTMSQDP
WFIKFYAPWCHHCQAMAPNWAQLAKEMKGKLNIGEVNCEAESRLCKDVHVRGYPTIHFFR
GGERVEYEGLRGLGDFITFANKAVDIGDGVKDIDAAEFTELEEKEDVIFVYFYDHATTSE
DFAALERLTLSLIGHAKLVKTNSAALADRYKITTWPRLLVSRDGRPTYYTALAPQDMRDF
RKVLHWMQSVWLPVVPELTASNSREIMDGKIVVLAILSRDREHDFEMAKKELKQAALEWM
DKQIINFQRERQELRDAKQLRLEEAEDRNDQRALRAAKSIRINMDKADQKEVGFAWVDGV
FWERWIRSTYGIEVKSDGEKVIINDEDNRRYWDTTITGNYIIPSRTSILETIPKVVVNPP
VIKPKSTVGSFEKAFFNVRGAISGHPFLSFGVALGMILGATMYGRGKIGARRGGFFRVDD
GGKDGLLGGVNGGGKVD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttctttcggtctcattattatcgactgtctttgcttctgtagtattagcacag
actggagaacaatcaatagagaatccctctcccgatttacctggtgaagaggaagctgct
gatgtaccacaaccaacaacatttaatggagttcaagtcccccctctacctgatatagac
ggagaactattcaatcagacagtcgcggaaggttactggtttgtcaaacatcactcacct
tattgcccgcattgtatccacattgcgccaacatggcaaactctctacgaattctattat
acttcgaagccagtcaaatcgggagctgaagataccgcatcgacttcattgaacactttc
tccgcctactacaactaccatttcggctctcttgattgtatcgctttcggaactgcttgt
acagatcatggcgtaacttctttcccaacatttattttatataaggatggcgaagaagca
aaacgattcgttggacctaaagacatggaaaagttgggtgcttttatcgaaggtaatcta
gaatcaatcagaccagggtctagaccaattggtggaccaaagtacccagaagaacgtgca
acacaaagtccggattatcagcctgaagcagctgcttcaaaggagaccgaaaagacaacc
gagaaatcgacagagaaagcatccgacaagtcatccgagaaagcatcagagaaatcgaca
gagaaagaatccgataagacatccgaaaaatcatcagagaaatctacagaaaagtcatct
gggggatctacgcagaaatcagagacaggagccgagaaagtaacagacaaggtcgcagac
gctgctgctccagtaaaagatgctgtcaaggatactgccgaaaatgtcaaggacagtgtt
aaggatgccgtcaaagaaacaaaacctgaagttgctaaaatcaccactaagcctatcctc
aaagccacaccaatcgaaaataagccttcaaaacctactcaaacggcgaacccactcggt
acatccgtatccctcacagccgagagctttcagaatttggttactatgtcacaagatcct
tggttcattaaattttacgctccatggtgtcatcattgtcaagctatggctcctaattgg
gctcaattggctaaggaaatgaaaggaaaactcaacatcggagaagtcaattgtgaagca
gagtctagattgtgcaaggacgttcacgttcgaggatatccaaccattcatttcttccgc
ggaggagaacgtgtggaatatgaaggacttagaggattgggtgattttattacctttgcc
aacaaagctgttgatattggagatggcgttaaggatattgatgcagccgagtttacggaa
ttggaggagaaagaagatgttatctttgtttacttctacgaccatgctactacaagcgaa
gatttcgctgcattggaaagattgactttgagtttgatcggacacgctaagcttgtcaag
accaacagtgctgctcttgcagatcgatacaagattacaacttggcctcgtttattggta
tcccgagatggtagaccaacttattatacagcactcgcacctcaagatatgcgcgatttc
agaaaggttcttcattggatgcaatctgtttggttacctgtcgttccagaactcacagct
tcgaactctcgcgaaatcatggatggtaaaattgttgtccttgcaatcctttctcgagac
cgcgaacatgatttcgagatggctaagaaggagttgaagcaagctgcattagaatggatg
gacaaacagataatcaatttccaacgtgaacgtcaagaattgagagatgcaaaacaactc
agattagaagaagcagaagatcgaaatgatcaaagagctttgagggctgctaagagtatc
agaatcaacatggacaaagctgatcaaaaggaggttggatttgcttgggttgatggagtt
ttctgggagagatggattagaagtacttatggtattgaagttaagagtgatggtgaaaag
gttattattaatgatgaagataatcgacgctactgggatacaacaattaccgggaactat
atcattccttctcgtacttcaattttggaaaccattcctaaggttgtagtaaacccacca
gtcatcaagccaaagagtacagtgggttcttttgaaaaagcattctttaatgttagaggt
gcaatttcaggccacccattcctcagttttggagttgcactaggaatgatcctaggtgct
acaatgtatggaagaggaaagattggtgcgagaagaggtggtttctttagggtagatgat
ggtggtaaggatggtttattgggtggtgttaatggtggtggaaaagttgattaa

DBGET integrated database retrieval system