KEGG   Botryotinia fuckeliana: BC1G_06757Help
Entry
BC1G_06757        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 574 aa AA seqDB search
MAPNKNSPLFASGRPSSSNSEERAAAEDDALLGNRPKNSYEAKRPGFWREIGLFTWAVVA
TAAVIVLGVLLSQSQQAPQKTKQNGKRNLIFMVSDGMGPASLSLTRSFRQFEGDLPINDI
LQLDQHFIGSSRTRSSSSLVTDSAAGATAFSCGRKSYNGAISMLPDHTPCGTVLEAAKRA
GYITGLVVTTDITDATPACFASHVDYRMQEDSIALQEVGEHPLGHRVVDLMLGGGRCHFL
PNTSESSCRADSRDVTKLAQDKYGWTYIDTREDFDKLKLGKKVQLPLLGLFSDTDIPFEL
DRRNMNDVYPSLDEMARTALTALEAAAKDSDKGFFLMIEGSRIDHAGHGNDPAAQVHEVL
AYDRAFQSVIDFLDKSDTEGALVATSDHETGGLAVARQLNPSYPQYLWYPEVLSNASHSS
EYLSRVLRAHVASEEAVTKGRPVSRRFVKEDLVKKGLGIMDATEEEIDRILDNPALSAYA
FADIISRRAQIGWSTHGHSAVDVNIYGYGADVLRGNHENIEVGKFLRDYLNVDVDAITAE
LNSKTNGQSLSAASTPDVPDFGRYEERLKKNLPQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaataaaaacagtccgctgttcgcgtcaggaagaccctcttcttctaattcc
gaagaaagagctgcggcagaggacgatgcgcttcttggtaatcgaccaaagaattcctac
gaagccaagagacctggattctggcgagagattgggctcttcacctgggctgttgttgcc
actgctgctgtcatcgtcctaggcgttttattgtcgcaaagccaacaagctccgcagaag
acaaagcaaaatgggaagcgcaatcttattttcatggtgagcgatggaatgggcccggca
tctttgagtttgacgagaagcttccgacaatttgaaggagatctaccgatcaatgatatt
cttcaactggatcaacattttatcggttcgtcgcgcacgagatcaagcagcagtcttgtc
acagatagtgcggcgggagctactgcattcagttgcggaagaaaaagctataatggcgca
atttctatgttgcctgatcacaccccttgtggcactgtacttgaagctgcgaaaagagcc
ggttatatcacgggcttggttgttacaacagacataacggatgcgaccccagcttgcttt
gcctcacacgttgattaccgaatgcaggaggactcgatagctttacaggaggttggagaa
catcctctcggacatcgagttgttgatttgatgttaggcggtggacggtgtcactttttg
cccaatacatcagaatctagttgcagagctgatagtcgcgatgtcacaaaactggcgcaa
gacaaatatgggtggacatacattgataccagagaggattttgacaaattgaagcttgga
aagaaggttcagctgccattgttgggtctcttttctgatacagacattcctttcgagctt
gatcgacgaaacatgaatgatgtctatccttcccttgatgaaatggcaagaacagctttg
accgcactcgaagctgcagccaaagatagtgataagggcttctttctcatgattgagggt
agtcgaatcgatcatgccggtcatggaaacgatccagctgcccaagtccacgaagtactt
gcctatgatcgagctttccaaagtgtaattgatttcctagacaagagcgatactgaaggt
gctcttgttgctacaagtgaccacgaaactggaggcttagctgttgcaagacaacttaac
ccttcataccctcaatatttatggtaccctgaggtgttgtcaaatgcttcccattcatca
gagtatctttctagggttctaagggctcatgttgcttcagaagaagcagttaccaaagga
cgccccgtcagcaggcgattcgtgaaagaagatctcgtcaaaaagggtctcgggatcatg
gacgcgactgaggaagagattgatcgcatacttgacaatccggcgctttctgcttatgct
tttgccgatatcattagccgtagagcacagatcggctggtcaacccacggccactctgct
gttgatgtcaacatctatggctatggtgctgatgttcttcgtggaaaccacgaaaatatc
gaagtcggcaaatttttgagagattatctcaatgttgacgttgatgcaatcacagcagaa
ctaaacagcaagactaatggtcaaagtctctcagcagcttcaacccccgatgttccagat
tttggacgatacgaggaaaggctcaagaagaacttgccacaatag

DBGET integrated database retrieval system